• AgoraVox sur Twitter
  • RSS
  • Agoravox TV
  • Agoravox Mobile

Accueil du site > Actualités > Technologies > Les origines du SARS-CoV-2 : la piste d’un double gain de (...)

Les origines du SARS-CoV-2 : la piste d’un double gain de fonction

JPEG

 

 1) Les cousins du SARS-CoV-2

 La science n’a pas encore élucidé les origines du SARS-CoV-2, ce virus dont l’origine est zoonotique et qui au milieu de l’année 2021 ; aura causé plus de 3 millions de décès dans le monde. Tous les virus circulants sont générés par des souches ancestrales modifiées par des mutations de plus ou grande ampleur. Deux questions se posent. Quel est le réservoir animal d’origine ? Quels événements biologiques ont conduit de la souche zoonotique vers la souche humaine SARS-CoV-2 extrêmement contagieuse et dix fois plus létale qu’une grippe. Le SARS-CoV-2 appartient à la sous-famille des sarbecovirus incluse dans la famille des bêtacoronavirus. Cette origine est clairement identifiable en analysant quelques motifs protéiques fortement conservés sur la sous unité S2 alors que la sous-unité S1 est bien plus variable et contient la clé d’attachement du virus aux membranes. D’abord le peptide de fusion sur la sous-unité S2 ; quelque 50 acides aminés sont conservés à la lettre près sur des souches retrouvées chez la chauve-souris, notamment sur la RaTG13 récupérée en 2013, ainsi que des virus prélevés ces dernières années sur des pangolins. Ensuite le code trypsine (site de clivage réalisé par protéine à sérine TMPRSS2) adjacent dont la formule est skpskrs. Le peptide de fusion est le même pour tous les sarbecovirus, y compris le SARS de 2003 dont le code trypsine est légèrement différent lkptkrs. Des virus animaux apparentés au SARS ont également ce code skptkrs. D’autres protéines sont extrêmement conservées. C’est par exemple le cas de la protéine accessoire ORF 6 (possédant une fonctionnalité anti-interféron) ou alors le domaine riche en sérine de la protéine N constituant la nucléocapside. L’origine animale ne fait aucun doute, ni le réservoir issu des chauves-souris, même si l’on ignore l’espèce intermédiaire. La souche la plus proche étant la RaTG13 dont l’homologie du génome est de 96%, ce qui semble peu mais représente beaucoup en nombre de mutations, les 4% d’un génome de coronavirus représentent tout de même quelque 1200 bases. Les variants du SARS-CoV-2 qui ont le plus muté après 15 mois de pandémie ne divergent que de 40 bases. En 2003, le SARS-CoV qui causa quelque 800 décès était issu d’un réservoir animal où figuraient les chauves-souris et les civettes palmées. Da divergence en base est de 20% par rapport au virus de 2019.

 

 Il est clair que SARS-CoV-2 est issu d’un réservoir de sarbecovirus composé de chauves-souris et de pangolins. Pour passer de la souche animale à la souche humaine il a fallu une série de transformations. Un virus ne saute pas facilement d’une espèce à une autre. Une ou plusieurs étapes intermédiaire sont plausibles :

 

 Pangolin ou Bat (2013-19) → SARS-X → (Y ?) → SARS-CoV-2 (2019)

 

 Une flèche représente une transformation dont le principe et le mode opérationnel sont explicités par le concept de « gain de fonction »

 

 2) Le concept et l’expérience de « gain de fonction »

 Les virus capables alors de franchir les barrières inter-espèces ou alors de modifier leur tropisme au sein d’une même espèce et par exemple, un virus respiratoire peut devenir entérique et inversement. Ces événements biologiques sont connus depuis des décennies ; ils ont été observés pour les coronavirus et les virus grippaux. Les virologues étudient en laboratoire comment un virus peut passer d’une espèce à une autre. Ils réalisent des expériences de « gain de fonction ». Le principe consiste infecter soit des cellules in vitro, soit des animaux, et d’observer si une souche infectieuse infecte une cellule ou bien un animal, générant alors des symptômes. Le génie génétique s’est invité dans ces expériences. En ce cas, le génome d’une souche virale est modifié et son potentiel infectieux est étudié. D’éminents infectiologues ont cru bon de signaler que la nature réalise parfois des expériences de gain de fonction. Mais la nature n’imite pas la science. C’est l’inverse, le gain de fonction est un processus par essence naturel, pouvant être étudié en laboratoire en utilisant un dispositif expérimental adéquat. C’est ce qui est réalisée depuis plus de deux décennies. Un papier publié en 2000 explique comment un coronavirus peut être « transformé » en virus chimérique et passer de la souris aux félins. Au cours de cette expérience, un gain de fonction a été observé pour le virus chimérique mais aussi une perte de fonction puisque les cellules de souris n’étaient plus infectées. Cette étude utilise la technique de recombinaison ciblée d’ARN :

 « La famille des Coronaviridae contient les agents responsables d'un certain nombre de maladies respiratoires et entériques importantes affectant les humains, d'autres mammifères et les oiseaux. L'une des caractéristiques de cette famille est que la plupart de ses membres présentent un très fort degré de spécificité pour l’espèce hôte, que l’on explique par les interactions des virions avec des récepteurs de cellules hôtes. (…) En utilisant la recombinaison d'ARN ciblée, nous avons construit un mutant du virus de l'hépatite de souris coronavirus (MHV) dans lequel l'ectodomaine de la glycoprotéine de pointe (S) a été remplacé par l'ectodomaine très divergeant de la protéine S du virus de la péritonite infectieuse féline. Le virus chimérique généré, appelé fMHV, a acquis la capacité d'infecter les cellules félines et a simultanément perdu la capacité d'infecter les cellules murines en culture tissulaire. Ce changement réciproque de tropisme appuie la thèse que le tropisme des coronavirus est déterminée principalement au niveau des interactions entre la protéine S et le récepteur du virus (…) le fMHV est potentiellement le virus receveur idéal pour réaliser la génétique inverse du MHV par recombinaison d'ARN ciblée, car il présente la possibilité de sélectionner des recombinants, aussi défectueux soient-ils, qui ont retrouvé la capacité de se répliquer dans les cellules murines. » (Kuo, 2000)

 Si j’ai choisi cette étude, ce n’est pas par hasard mais parce qu’elle place sous les radars la protéine S, dite de pointe ou spicule, devenue emblématique à l’époque du SARS-CoV-2. En règle générale, tous les virus utilisent une porte d’entrée spécialement adaptée, sélectionnée, et qui est une protéine dotée d’une double fonctionnalité, l’adhésion à la membrane externe de la cellule hôte et la fusion permettant au virion d’entrer dans le cytoplasme pour réaliser les étapes de réplications.

 

 3) Les craintes liées aux expériences de gain de fonction

 Il y a 20 ans, les expériences sur les coronavirus n’étaient pas considérées comme potentiellement risquées, voire dangereuses. Et pour cause, à cette époque, les coronavirus étaient perçus comme des virus anodins, devenus courants et tout simplement embêtants pour les humains, produisant des rhumes à répétition. La situation allait changer avec l’apparition du SARS-CoV en 2002 et les quelques 800 décès causés en 2003, plus quelques 8000 infectés par ce « nouveau coronavirus ». En France, la canicule laissa dans l’ombre cette épidémie qui fut aussi vite oubliée que contenue. Le nouveau coronavirus de 2003 était en effet peu contagieux et seuls les symptomatiques pouvaient transmettre le virus. En revanche, les radars de l’infectiologie se portèrent vers le plus redouté des virus potentiellement pandémiques, le H5N1 aviaire. Il arrive parfois que des virus passent la barrière entre oiseaux et mammifères. C’est aussi le cas pour les coronavirus de type gamma et delta dont le réservoir d’origine est aviaire. Puis arriva la pandémie grippale H1N1 de 2009 qui fut redoutée parce que le virus était un H1N1 comme celui de la grippe espagnole et qu’il résultait d’un réassortiment avec un virus porcin, si bien que cette maladie, désignée abusivement comme grippe mexicaine en raison de son origine géographique, fut nommée tout aussi improprement grippe porcine. A cette époque, les laboratoires ont poursuivi les expériences de gain de fonction sur les virus grippaux. Une vive controverse agita la communauté scientifique il y a une décennie. Le sigle GOF, lorsqu’il désigne une expérience faite avec les virus grippaux, a pris une un sens péjoratif, signifiant quelque chose de dangereux, risqué, voire même infâme, alors que GOF ne désigne qu’une seule chose, l’acquisition par un virus d’une propriété supplémentaire (Casadevall, 2014).

 Le processus inverse de perte de fonction est tout aussi répandu dans la nature et d’ailleurs, la perte de fonction semble accompagner l’évolution des virus, avec la déperdition génétique, autrement dit la perte de fonctionnalités fondamentales. A l’exception des virus géants, les virus infectant les espèces n’ont pas de gènes pour le métabolisme ni la fabrication des protéines. Le cas des coronavirus est exemplaire. Ces virus appartiennent à l’ordre des nidovirales composé de virus à ARN de polarité positive. Les coronavirus ont comme spécificité un génome de très grande taille, dont la réplication fait intervenir une exonucléase (nsp14) censée corriger les erreurs. Les nidovirus dont le génome est la moitié de celui d’un coronavirus sont dépourvus de l’exonucléase, ce qui traduit une perte de fonction pour ce type de virus. Cette déperdition génétique intéresse de près les chercheurs en génétique des virus, offrant des indices sur l’évolution des virus et leur séparation phylogénétique. En revanche, les gains et perte de fonction observés en laboratoire et dans la nature concernent de petites modifications dont les conséquences peuvent être très importantes, avec un changement de tropisme. Les coronavirus sont redoutables avec leur mécanisme complexe utilisant l’exonucléase nsp14 et un procédé de réplication utilisant des ARN subgénomiques. Ces outils permettent au coronavirus de se transformer par recombinaisons puis de se stabiliser en limitant les erreurs de copie. Ils échangent des « cassettes » comme le disent les virologues. C’est comme s’ils se passaient des mini clés UBS contenant des motifs, des codes spéciaux. En revanche, les alphavirus et picornavirus, eux aussi pourvus d’un ARN positif, ne disposent pas d’exonucléase ; ils mutent alors avec la multiplication des erreurs de copie.

 Les expériences de gain de fonction sont devenues habituelles. Mais la donne a changé et nous voyons actuellement des virologues réputés mettre en cause ces expériences dans le contexte de la pandémie de Covid. L’un d’entre eux a même considéré que ces expériences visant à mieux connaître la circulation des virus revenait à détecter une fuite de gaz en utilisant une allumette.

 

 4) Retour vers le futur avec l’épidémie de SARS-CoV en 2003

 

 a) En 2011, nous pouvions lire ces lignes prémonitoires écrites dans une mini revue signée Rachel Graham et Ralph Baric : « En nous appuyant sur des évidences scientifiques, la question sur l’émergence d’un coronavirus hautement pathogène n’est pas de savoir si cet événement aura lieu mais quand il se produira. La grande inconnue concerne la possibilité de contrôler l’épidémie et de développer des traitements ou des vaccins efficaces » (Graham, 2011). Cette revue est remarquable à plus d’un titre. Elle met l’accent sur les mécanismes moléculaires impliqués dans les infections à coronavirus tout en précisant comment ces virus diffusent dans les réservoirs animaux et passent parfois chez les humains. Ou alors d’une espèce animale à une autre, occasionnant chez l’espèce ayant reçu le virus en état de fonctionner une pathologie. C’est ce qui a été observé depuis quatre décennies pour les félins, les visons, les chiens, les bovins, les porcs, infectés par des virus ayant changé leur tropisme.

 Chez l’homme, deux coronavirus peu agressifs mais assez contagieux circulent depuis au moins six décennies, le 229E et le OC-43. Après la crise du SARS en 2003, deux autres coronavirus ont été observés en 2004 et désignés « nouveaux coronavirus » ; le NL-63 et le HKU1. Le NL-63 a été identifié sur des prélèvements effectués sur un jeune enfant atteint de bronchiolite sévère et de conjonctivite. C’est le quatrième coronavirus pathogène pour l’homme. Sa séquence indique que ce n’est pas un virus recombinant mais une souche nouvelle appartenant au groupe alpha (comme le 229E) dont la partie N-terminale de la protéine S est unique en son genre. Mais d’autres études énoncent la possibilité d’une succession de nombreuses recombinaisons à l’origine du NL-43 (Graham, 2011). Ce virus a été retrouvé sur d’autres patients d’âge jeune et donc caractérisé comme un nouveau pathogène (van der Hoek, 2004).

 Le HKU1 a été séquencé à partir d’un prélèvement nasopharyngé sur un patient âgé de 71 revenant de Shenzen et atteint d’une pneumonie (Woo, 2005). Le HKU-1 a été lui aussi catégorisé comme nouveau coronavirus pathogène mais appartenant au groupe bêta. Il aurait même été actif à l’époque du SARS, détecté sur une patiente de 35 ans souffrant de pneumonie et testée négative au SARS-CoV. Ces deux nouveaux virus ne sont visiblement pas très contagieux, circulant à basse intensité et causant des troubles quelques fois sérieux. En revanche, ils montrent que la série des souches contagieuses de coronavirus s’est étendue. Rien qu’entre 2002 et 2012, quatre virus sont apparus, dont les terribles SARS-CoV et MERS-CoV.

 

 b) Nul ne sait quand et comment les nouvelles souches émergent. En revanche, les analyses génétiques et les expériences menées en laboratoire permettent de tracer un schéma universel associant deux éléments, la modification du génome (recombinaison et/ou mutation) et le gain de fonction. Les coronavirus sont connus pour leur capacité à générer des recombinaisons homologues qui sont en réalité des processus universels du vivant, employé par les génomes des espèces lors de la méiose, ce qui permet d’échanger des morceaux de texte génétique. Les évolutionnistes pensent que ces processus contribuent largement à l’émergence des espèces. Le point sensible des coronavirus, c’est la protéine S, la deuxième en taille, quelque 1300 acides aminés. Le génome du SARS-CoV contient au moins sept domaines accessibles aux recombinaisons repérés sur les gènes de la réplicase et de la protéine S. Ces recombinaisons se produisent lors d’infection croisées et n’ont rien de stochastique. La recombinaison homologue est au contraire un mécanisme employé par le vivant pour on ne sait quelle stratégie ni quelle finalité inhérente aux espèces et pourquoi pas, aux virus ou du moins à l’infection virale, étant entendu qu’on ne peut pas dissocier l’objet virus comme on le fait pour l’objet conceptuel espèce. Un virus ne se conçoit pas indépendamment de la relation complexe qu’il établit avec l’hôte. A l’instar du langage inconcevable indépendamment des locuteurs.

 Les coronavirus semblent sauter assez facilement d’une espèce à une autre. Les observations et analyses ont montré que les gains de fonction causant les changements de tropisme sont imputables pour l’essentiel aux codes d’entrée de la protéine S. Après l’épisode épidémique de 2003, des cas d’infections zoonotiques ont été observés en Chine lors de l’hiver 2004, sans pour autant produire une résurgence de l’épidémie. Des patients ont été contaminés par la civette palmée. Les virologues ont trouvé 99.8% d’homologie en comparant le SARS humain et le SARS-like prélevé sur des civettes himalayennes vendues sur le marché de Shenzhen. Le chien viverrin (racoon dog), prisé pour sa fourrure, a lui aussi été considéré comme un transmetteur potentiel du virus SARS vers l’homme. Les transmissions de l’animal à l’homme sont des événements viraux sans doute plus fréquents que ne l’indiquent les surveillances épidémiologiques. En 2013, six travailleurs ont été infectés dans une mine du Yunnan par une souche RaTG13 de chauve-souris. A Hong Kong, des analyses sérologiques en 2001 sur des sujets en bonne santé ont trouvé des anticorps dirigés contre des virus de type SARS, laissant penser qu’un nombre conséquent de patients ont été en contact avec un SARS-CoV deux ans avant l’épidémie menaçante de 2003 (Graham, 2011). La plupart de ces événements sont sans incidence épidémique sauf dans de rares cas où un nouveau virus apparaît, « gagne en fonction » pour « coloniser » le réservoir humain et devenir un agent épidémique ou endémique.

 

 5) L’hypothèse du double gain de fonction

 Le SARS-CoV de 2003 avait un tropisme bien précis, infectant les poumons mais aussi les voies digestives. Les patients affectés par le SDRAS étaient atteints de pneumonie et assez souvent de troubles gastro-intestinaux. Les sarbecovirus sont connus pour occasionner chez les mammifères des troubles entériques. Le nouveau virus apparu à Wuhan possède lui aussi les deux tropismes, pulmonaire et entérique, auxquels s’ajoute un tropisme nasopharyngé. C’est ce tropisme supplémentaire qui explique la puissante contagiosité du SARS-CoV-2, véhiculé par les gouttelettes nasales expulsés dans l’air. Ce virus est de plus transmissible par des patients présentant des symptômes légers voire aucun symptôme. Tout se passe comme si le virus de 2019 était issu d’un virus de type H-CoV-SARS après avoir été transformé par un ou deux gains de fonction très avantageux puisque le virus est devenu contagieux avec son tropisme des voies respiratoires supérieures. Ce nouveau tropisme rend le virus plus contagieux, ce qui n’exclut pas un gain de fonction pour l’infection pulmonaire responsable de la dangerosité du SARS-CoV-2, capable de propager sur l’épithélium alvéolaire dont la surface totale est tout de même chiffrée en dizaines de mètres carrés.

 

Un fait n’a pas échappé aux virologues ; il est même devenu un point central dans l’enquête sur l’origine du virus. La protéine S du SARS-CoV-2 possède deux sites de clivage, autrement dit deux codes d’entrée. Le code trypsine skpskrs associé au peptide de fusion et un code furine sprrars placé au milieu de la protéine et censé être clivé par la furine. Voici la séquence exacte de ce domaine pour la protéine S appartenant au coronavirus de Wuhan et en dessous, à la souche RaTG13 récupérée en 2013 sur une chauve-souris. La troisième séquence figure sur un virus de pangolin enregistré en 2020

 

661 ecdipigagicasyqtqtnsprrarsvasqsiiaytmslgaensvaysnnsiai (SARS-CoV-2)

661 ecdipigagicasyqtqtns (...) rsvasqsiiaytmslgaensvaysnnsiai (RaTG13)

661 ecdipvgagicasyhsms sfrsvnqrsiiaytmslgaensvaysnnsiai (GenBank : QIQ54048.1)

 

Le motif prrars est reconnu par la protéase transmembranaire furine. C’est ce motif qui distingue le SARS-CoV-2 des autres souches animales dont certaines protéines sont similaires. On note la conservation à 100 % de deux protéines, l’une est la protéine E de l’enveloppe, elle est structurale, l’autre est la protéine accessoire codée par la séquence ORF6 et qui a été impliquée dans l’interférence entre le SARS-CoV-2 et la signalisation immunitaire (voir mon précédent article). La comparaison des gènes montrent une conservation remarquable des gènes codant pour E, et ORF6, respectivement 99.6 et 98.4 (Zhou, 2020). Ce qui signifie, en supposant une filiation entre RaTG13 et H-CoV, une mutation silencieuse pour le gène N et trois mutations pour le gène ORF6. En revanche, d’autres gènes sont moins conservés. Le domaine de liaison RBD sur S diverge de 10% en acides aminés, ce qui représente tout de même quelque 20 substitutions et ne surprend pas car ce domaine est connu pour ses variations d’une souche à une autre et au sein d’une même souche, d’un variant à un autre. Si vous suivez l’actu, N501Y et E484 désignent les mutations observées sur les nouveaux variants du coronavirus si redoutés.

 Le motif furine polybasique est surveillé par les virologues. Il a été observé que l’acquisition d’un site polybasique sur l’hémagglutinine des virus grippaux les rend beaucoup plus contagieux (voir par ex. Tscherne, 2011). Ces indices penchent en faveur d’une succession de deux « gains de fonction » permettant de reconstituer la filiation entre un coronavirus zoonotique et le virus apparu à Wuhan fin 2019. Autrement dit, un virus intermédiaire, le SARS-X, aurait circulé en étant faiblement contagieux puis aurait muté et se serait transformé en SARS-CoV-2 grâce aux modifications sur la protéine S, apparition du site furine et peut-être quelques autres mutations avantageuse sur le domaine de liaison (RBD).

 

 6) Le scénario du double GOF est-il plausible ? Esquisse d’un scénario épidémique à deux épisodes

 

 a) Nous disposons de rares éléments permettant d’y voir clair. En premier lieu, la souche RaTG13 récupérée en 2013 dans une mine située dans le Yunnan, est aussi un fait infectiologique. Un doctorant chinois a révélé dans sa thèse que six travailleurs (dont trois décédèrent) chargés de nettoyer cette mine (en avril 2012) ont été affectés par des symptômes comparables à ceux du SDRAS de 2003 et au Covid de 2019. Troubles entériques, fièvre, pneumonie et signature hyperinflammatoire confirmant une infection virale. Les transmissions zoonotique du sarbecovirus de chauve-souris ou d’autre espèces sont des possible mais très rares. Pour qu’un virus se transmette d’homme à homme, il faut un gain de fonction qui se produit lors de l’infection et crée un virus modifié et adapté au nouveau réservoir. C’est ce qui s’est produit en 2002 et a généré le virus épidémique peu contagieux mais assez létal, causant 800 décès. Trouver l’origine du SARS-CoV-2 sera plus difficile que celle du premier SARS. Contrairement au virus de 2002, on n’a pas trouvé de souche animale approchant les 100 % d’homologie ; la plus proche étant RaTG13 avec 4% de divergence. Nous sommes dans la situation du HCoV-NL63, autrement dit un nouveau virus pouvant être issu d’une souche ancestrale ayant subi plusieurs recombinaisons. Aucune souche animale très proche ne figure dans les datas centers répertoriant les virus prélevés et séquencés.

 L’origine naturelle du nouveau virus s’explique avec une ou deux étapes (voire plus). Un scénario à deux phases est plausible. D’abord une transmission zoonotique chez un ou plusieurs patients zéro et un gain de fonction produisant l’hypothétique SARS-X causant une première contagion entre humains. Ce virus intermédiaire serait un sarbecovirus faiblement transmissible, issu d’un animal, recomposé par gain de fonction chez l’homme, et proche du SARS de 2002, doté d’un tropisme pulmonaire et entérique. Si la thèse à deux étapes se tient, elle doit être appuyée par quelques observations cliniques remontant bien avant le premier décembre. Quelques rares cas de pneumonie plus ou moins atypiques ont été signalés en octobre et novembre mais il faut être prudent, ces pneumonies pouvant être causées par le HCoV-NL-63 ou bien les nouveaux métapneumovirus circulant depuis deux décennies. Sans séquence obtenue en RT-PCR, la présence d’un sarbecovirus X reste une pure hypothèse. Nous n’avons pas les traces exactes indiquant la circulation d’un SARS-related virus durant l’automne 2019. Tout au plus quelques maigres indices provenant de France et d’Italie. Les éléments les plus significatifs sont les jeux militaires de Wuhan. Ils figurent en annexe pour ceux que cette affaire intéresse.

 Une étude publiée le 18 mars dans la revue PNAS a estimé la date d’émergence du SARS-CoV-2 en utilisant la méthode de l’horloge phylogénétique. Le virus serait apparu entre la mi-octobre et la mi-novembre 2019 (Pekar, 2021). Il est difficile de tirer des conclusions. Les auteurs n’excluent pas la possibilité d’un hôte intermédiaire entre la souche endémique animale et la souche humaine pandémique. Ils envisagent que le virus ayant émergé comme souche transmissible aurait pu être beaucoup moins apte à se propager, auquel cas, s’il avait été détecté précocement, la pandémie ayant flambé dans le Hubei aurait pu être stoppée. Finalement, cet hôte intermédiaire ne serait-il pas l’homme, en supposant le virus X intermédiaire qui aurait circulé modérément ; un peu à la manière d’un départ de feu ? Ce scénario à deux phases reste donc plausible. Un départ de feu avec un virus peu contagieux mais laissant quelques signes de son passage avec des pneumonies sporadiques puis un gain de fonction majeur et cette fois, le départ de feu se transforme en incendie pandémique. Départ de feu mais où ?

 

 b) Un gain de fonction naturel décrit sans l’expliquer comment un virus saute la barrière d’espèce en infectant l’homme. Ce virus ne devient pas un virus humain, sauf si en se reproduisant dans un hôte, il parvient à acquérir les mutations pour passer d’un humain à un autre. Ces événements se sont produits à plusieurs occasions, faisant émerger des virus respiratoires peu dangereux. Les virus sont transformés par les hôtes qu’ils infectent. Seule une recombinaison de grande ampleur, en une ou plusieurs étapes, peut expliquer comment on passe d’un virus animal adapté à son réservoir à un virus adapté à l’humain du type SARS-CoV-2, capable de créer une pandémie, dont la divergence avec les souches les plus proches dépasse les mille bases. Lorsqu’un virus saute la barrière, il se recombine avec une rapidité et une ampleur assez conséquentes. L’origine du SARS-CoV-2 risque de rester une énigme pour des raisons liées à l’ignorance scientifique, auxquelles s’ajoutent les restrictions d’informations des autorités chinoises.

 

 Pour résumer, l’origine du virus apparu en décembre 2019 répond à quatre scénarios possibles

 

Zoonose →  GOF1 naturelle →  → pandémie déclenchée

Zoonose → GOF1 naturelle → GOF2 naturelle → pandémie déclenchée

Zoonose → GOF1 laboratoire→ A → → pandémie déclenchée

Zoonose → GOF1 Laboratoire→ A→ GOF2 naturelle → pandémie déclenchée

 

 Dans les deux premiers scénarios, un ou plusieurs patients zéro ont été contaminés par un virus animal. Ensuite, un gain de fonction naturel s’est produit chez un patient, rendant le virus transmissible. Ce virus pouvant être le SARS-CoV-2 apparu en une seule étape ou alors un virus intermédiaire X peut contagieux, circulant à bas bruit, pour devenir hautement transmissible à la faveur d’un second gain de fonction. Les deux derniers scénarios sont écrits en remplaçant la première étape par une manipulation et un accident de laboratoire A faisant circuler soir le virus pandémique, soit un virus intermédiaire X amené à muter naturellement chez certains sujets.

 

 c) Pour connaître la filiation exacte de l’animal vers le virus pandémique de 2019 il faudrait trouver le chaînon manquant dans les bases de données. Les virologues n’ont rien trouvé. De plus, les autorités chinoises semblent rechigner à livrer les informations. L’opinion pense que la Chine cache quelque chose, pas forcément un accident de laboratoire. Si le scénario du virus X est plausible, la piste d’une faute de surveillance n’est pas exclue, tout comme n’est pas exclue l’idée que les méthodes de surveillance ne sont pas infaillibles. Il y a toujours quelque chose de vain à vouloir refaire l’histoire, même si la reconstitution d’un scénario peut être utile pour prévenir les accidents. Encore faut-il être vigilant. L’explosion de l’usine AZF à Toulouse en 2001 n’a pas empêché la réplique de cet événement à Beyrouth en 2020.

 La « mécanique » des virus est au final simple dans son principe. Elle répond au concept du gain de fonction. Un virus qui fonctionne est une particule protéonucléique qui a réussi à déjouer l’immunité de l’hôte. Le réservoir viral des chauves-souris est le plus diversifié. Il est fort possible que le franchissement de la barrière humaine par un coronavirus (ou d’autres souches, nidovirus, picornavirus etc.) se soit produit à maintes reprise. Les départs de feu n’ont pas provoqué un incendie épidémique. En revanche, avec le SARS-1 un feu épidémique s’est produit et avec le SARS-2 en 2019 et peut-être qu’il s’est produit deux départs de feu successifs, avec deux gains de fonction. 

 

 

Lili Kuo, Gert-Jan Godeke, Martin J. B. Raamsman, Paul S. Masters, Peter J. M. Rottier ; Retargeting of Coronavirus by Substitution of the Spike Glycoprotein Ectodomain : Crossing the Host Cell Species Barrier ; Journal of Virology 2000, 74 (3) 1393-1406 ; https://jvi.asm.org/content/jvi/74/3/1393.full.pdf

 

Arturo Casadevall, Michael J. Imperiale ; Risks and Benefits of Gain-of-Function Experiments with Pathogens of Pandemic Potential, Such as Influenza Virus : a Call for a Science-Based Discussion ; mBio Aug 2014, 5 (4) ; https://mbio.asm.org/content/5/4/e01730-14.short

 

D.M. Tscherne, A. García-Sastre ; Virulence determinants of pandemic influenza viruses ; J Clin Invest. 2011 ;121(1):6-13. https://doi.org/10.1172/JCI44947.

 

van der Hoek, L., Pyrc, K., Jebbink, M. et al. ; Identification of a new human coronavirus. ; Nat Med 10, 368–373 (2004). https://doi.org/10.1038/nm1024

 

Jonathan Pekar, Michael Worobey, Niema Moshiri, Konrad Scheffler, Joel O. Wertheim ; Timing the SARS-CoV-2 index case in Hubei province ; Science 18 Mar 2021

https://doi.org/10.1126/science.abf8003

 

Patrick C. Y. Woo, Susanna K. P. Lau, Chung-ming Chu et al. ; Characterization and Complete Genome Sequence of a Novel Coronavirus, Coronavirus HKU1, from Patients with Pneumonia ; Journal of Virology 2005, 79, 884-895, https://jvi.asm.org/content/79/2/884.short

 

Zhou et al. ; A Novel Bat Coronavirus Closely Related to SARS-CoV-2 Contains Natural Insertions at the S1/S2 Cleavage Site of the Spike Protein ; Current Biology, October 05, 2020

https://doi.org/10.1016/j.cub.2020.05.023

 

 

Observations annexes sur les jeux militaires de Wuhan

 

Recension sommaire sur l’épidémie des jeux militaires de Wuhan

https://prospect.org/coronavirus/did-the-military-world-games-spread-covid-19/

 

S. Quay

https://zenodo.org/record/4119263#.YEyz_p1Kjcs

 

 Les médias ont parlé d’un cluster épidémique lors des jeux militaires de Wuhan organisés du 18 au 27 octobre, réunissant quelque 9000 athlètes et 200 000 volontaires mobilisés pour permettre le bon déroulement de l’événement, le plus important dans le domaine sportif et militaire jamais organisé en Chine, avec quelque 100 nations représentées. Des dizaines de sportifs, italiens, français, belges, suisses, américains entre autres, ont déclaré avoir été malades, avec des signes gastro-entériques, de la fièvre, de la toux, une fatigue inhabituelle et parfois des difficultés à respirer. L’athlète française Elodie Clouvel a raconté avoir été malade, signalant de nombreux cas disséminés au sein des différentes délégations. Son compagnon Valentin fut aussi affecté, précisant avoir eu des symptômes jamais connus auparavant. Le célèbre escrimeur italien Matteo Tagliariol a déclaré au journal Corriere della Sera qu'il était tombé malade presque immédiatement après son retour de Wuhan : « Quand nous sommes arrivés à Wuhan, nous sommes presque tous tombés malades », a déclaré Tagliariol. « Mais le pire a été le retour à la maison. Au bout d'une semaine, j'avais une fièvre très élevée, je sentais que je ne respirais pas », a ajouté Tagiariol, 37 ans. « La maladie n'est même pas partie avec les antibiotiques, je me suis rétabli au bout de trois semaines et je suis restée affaiblie pendant longtemps. Puis mon fils et ma compagne sont tombés malades. Quand ils ont commencé à parler du virus, je me suis dit : moi aussi, je l’ai. »

 Des dizaines de participants provenant de France, Italie, Suisse, Amérique, Belgique et autres nations, auraient ainsi été infectés à la fin du mois d’octobre. Si l’agent avait été le SARS-CoV-2, pourquoi l’épidémie aurait dû flamber plus tôt. La thèse d’un virus intermédiaire, le SARS-X, aux spécificités comparable à celui de 2003, est plausible. Autrement dit un virus entérique et pneumonique très peu contagieux, sauf en cas de contact rapproché et durable. Steven Quay a enquêté sur la dissémination du virus pandémique en mentionnant quatre patients enregistrés à l’hôpital militaire PLA de Wuhan le 10 décembre et dont les symptômes remonteraient plus tôt. Cet hôpital militaire est desservi par la ligne 2 du métro wuhanais dont l’une des stations dessert le marché de fruits de mer où le premier cluster de Covid fut observé fin décembre. Cette ligne 2 est également empruntée par les passagers rejoignant l’aéroport international de Wuhan desservant les grandes villes asiatiques, européennes et américaines. Cet élément corrobore l’histoire du virus qui aurait « navigué » autour de la ligne 2 mais quel virus ? Le SARS-X ou le SARS-CoV-2 ? 

 Que la ligne 2 du métro soit un élément du scénario ou pas, la thèse du double gain de fonction est plausible. Un SARS-X serait apparu à la fin de l’été ou ou début de l’automne avec une épidémie restreinte, constatée lors des jeux militaires à Wuhan, causée par un virus peu contagieux mais ayant circulé. Le SARS-CoV-2 aurait alors émergé début décembre. La chronologie phylogénétique publiée sur le site nextstrain indique une émergence du premier clade 19A entre le 27 novembre et le 20 décembre. C’est à cette date que le second gain de fonction se serait produit, faisant émerger le virus que l’on connaît en ajoutant les mutations adéquates pour faire du SARS-X un virus hautement contagieux, pourvu d’un tropisme affectant les voies respiratoires supérieures, avec un code furine entre autres modifications.

 


Moyenne des avis sur cet article :  2.46/5   (28 votes)




Réagissez à l'article

49 réactions à cet article    


  • pierrot pierrot 22 mars 11:21

    Article intéressant, mais ce ne sont que des hypothèses qui restent à étayer ce qui ne sera pas facile à établir.

    L’OMS travaille aussi dans cette voie mais sans avoir conclu actuellement.

    Les hypothèses de dysfonctionnement ou de fuite d’un laboratoire semble très peu plausible ainsi que celle d’une volonté maligne.


    • Bernard Dugué Bernard Dugué 22 mars 12:58

      Pour info, les chauves-souris représentent plus de 20% des espèces animales

      Elles hébergent 28 familles de virus, par exemple astrovirus, herpesvirus, parvovirus. Près de 10 000 souches et variants ont été identifiés


      • alanhorus alanhorus 22 mars 13:17

        La piste c’est qu’ils ont fabriqué le virus et toute l’ampleur et entourage mediatico policier franc maçon pour refourgué un vaccin vereux qui tue et rapporte un pognon de dingue.


        • Bernard Dugué Bernard Dugué 22 mars 13:43

          Complément d’info

          Pangolin, Bat… (2013-19) → SARS-X → (Y ?) → SARS-CoV-2 (2019)

           

          Une flèche représente une transformation dont le principe et le mode opérationnel sont explicités par le concept de « gain de fonction ». J’ai mentionné le pangolin parce que cette espèce est connue pour héberger des sarbecovirus. Bien évidemment, je n’ai rien contre cet animal. Le virus de Wuhan pourrait tout aussi bien avoir son origine zoonotique chez le vison ou mieux encore, un viverridé comme la civette palmée ou le chien viverrin.


          • Bernard Dugué Bernard Dugué 22 mars 13:56

            https://pubmed.ncbi.nlm.nih.gov/26475793/

            Les chauves-souris ont été identifiées comme des réservoirs naturels de nombreux virus, y compris des réovirus. Des études récentes ont démontré la transmission interspécifique des réovirus de chauve-souris à l’homme. Dans cette étude, nous rapportons l’isolement et la caractérisation moléculaire de six souches d’orthoréovirus de mammifères (MRV) d’Hipposideros et Myotis spp. Ces isolats ont été regroupés en MRV sérotype 1, 2 ou 3 sur la base des séquences du gène S1, qui code pour la protéine d’enveloppe externe s1. Surtout, nous avons constaté que trois des six souches de MRV de chauves-souris partageaient une forte similitude avec les MRV isolés de visons, de porcelets ou d’humains malades sur la base du segment S1, ce qui suggère qu’une transmission interspécifique s’est produite entre les chauves-souris et les humains ou les animaux.


            • Citoyen de base 22 mars 14:00

              @ auteur :

              Votre article est probablement un des plus étayés sur la réalité scientifique du coronavirus mais il me laisse sur ma faim. Toutes ces informations techniques sont très arides pour un profane et ne permettent guère de se faire une opinion sur la seule question qui vaille : ce virus est-il d’origine naturelle ou artificielle ? Et s’il est d’origine artificielle, sa diffusion a t’elle été accidentelle ou intentionnelle ?

              Mais probablement ne le saura t’on jamais. Comme on ne saura jamais qui a vraiment tué Kennedy, quelle est la vérité derrière les attentats du 11 septembre 2001, ainsi que tant d’autres manipulations.


              • Bernard Dugué Bernard Dugué 22 mars 14:25

                @Citoyen de base Il est évident que si le virus a été créé en labo et que sa diffusion a été intentionnelle, le type qui a fait ça ne va pas le crier sur les toits. En l’état actuel des connaissances, je privilégie la piste naturelle. Le NL-63 est apparu à partir d’un alphacorona, il a acquis la capacité à se lier à ACE2. Pareil pour le SARS-1 qui se lie à ACE2. Le mécanisme de passage vers l’homme est connu. La seule énigme, c’est pourquoi le CoV de 2019 a acquis un tropisme nasal qui l’a rendu extrêmement contagieux


              • alanhorus alanhorus 22 mars 17:07

                @Bernard Dugué
                Tout à fait.
                L’œuf ou la poule ?
                https://fr.wikipedia.org/wiki/Paradoxe_de_l%27%C5%93uf_et_de_la_poule

                Un virus sort il tout seul du chapeau du pangolin ?
                La suite de la Chute de la Cabale Part 9 : Gates joue à l’apprenti sorcier avec les OGM
                https://odysee.com/@NeufdeCoeur:1/part-9:7
                https://odysee.com/@NeufdeCoeur:1/Part-10-ok:a


              • Réflexions du Miroir Réflexions du Miroir 22 mars 18:06

                @Bernard Dugué,
                 Bien d’accord. A part, l’idée de Ronald Reagan qui voulait créer la bombe à neutrons, une bombe qui ne détruit pas ce qui est immobilier mais qui tuerait tout le monde du vivant dont on fait tous partie.
                 Les gaz pendant la guerre 14-18 pouvaient revenir sur les siens en fonction du vent.
                 On ne crée pas une arme qui a des retombées aléatoires. Une arme sert pour éliminer des ennemis.
                 Les virus sont naturels, nombreux et sont même nécessaires à notre système vivant dans notre organisme pour des fonctions vitales et le microbiote parvient à transformer toutes nos nourritures en une matière fécale plus ou moins uniforme. 

                 Penser le contraire, cela fait partie des fantasmes du complotisme.


              • Réflexions du Miroir Réflexions du Miroir 22 mars 18:10

                @alanhorus,
                 Si vous aimez les bonnes histoires « délicates », j’ai introduit à la fin de mon dernier billet : « L’injuste destin du pangolin » qui avait été écrit par plusieurs personnes lors de la première vague.
                 (Remarque : il faudra attendre un peu : le site est en panne pour le moment)


              • @Réflexions du Miroir

                Penser le contraire, cela fait partie des fantasmes du complotisme.


                Parce que bien sûr aucune puissance militaire n’a jamais songé une seule seconde à développer des armes bactériologiques, inclus des maladies virales. Jamais ! Bouh ! Complotiste...

                Tu es un âne, Guy.


              • Réflexions du Miroir Réflexions du Miroir 22 mars 18:37

                @alanhorus,
                 « Injuste destin du pangolin » écrit lors de la première vague par plusieurs auteurs.


              • Réflexions du Miroir Réflexions du Miroir 22 mars 18:38

                @Philippe Huysmans, Complotologue
                 Et toi ma poule, un con de première.
                 Comme ça dans notre monde on forme un tout. smiley


              • @Réflexions du Miroir

                Tu n’aimes pas beaucoup qu’on te mette le nez dans tes déjections, Guy ? T’as qu’à en écrire moins ou te contenter de les écrire là où personne ne risque de les lire, comme ton blog-en-panne.


              • Réflexions du Miroir Réflexions du Miroir 22 mars 19:05

                @Philippe Huysmans, Complotologue,
                 Encore une fois, t’as rien pigé.
                 Je le répète : j’en ai rien à ciré. Mon blog n’en est pas un. C’est un journal personnel qui existe depuis 16 ans. Rien à cirer que tu y viennes ou non, donc. Alors, une panne, cela peut se passer quand il y a un bug quelque part sur le site général comme je le disais un peu plus haut. 
                 Tu sais, un âne n’a jamais été con, tandis qu’une poule.... ca craint...
                 Tiens je te réserve quelque chose.
                  Attention, il faudra avoir de la dérision et de l’autodérision ce que d’après moi tu exempté à la naissance
                 Cela faisait partie du Grand Catus de hier après-midi..
                  et j’en ai podcasté un extrait
                 


              • @Réflexions du Miroir

                Je le répète : j’en ai rien à ciré. Mon blog n’en est pas un. C’est un journal personnel.

                Bescherelle ta mère, Guy. Ca yen a différent infinitif et participe passer !

                Alors, une panne, cela peut se passer quand il y a un bug quelque part sur le site général


                J’ai une autre explication : ton blog, probablement contaminé par Mme Lia s’est rendu compte qu’il était d’une nullité affligeante, et dans un acte désespéré consécutif à une brutale décompensation, il a mis fin à sa misère. Rip, pauvre petit journal parti trop tôt smiley

                Attention, il faudra avoir de la dérision et de l’autodérision ce que d’après moi tu exempté à la naissance


                Je veux bien essayer de faire traduire ça par google trad, mais faut d’abord que tu me dises dans quelle langue t’as essayé d’écrire...


              • The White Rabbit The White Rabbit 22 mars 19:12

                @Réflexions du Miroir

                Ce n’est plus à démontrer.

                Mais ne soyez pas trop injuste avec notre compotologue belge , il en est encore à chercher les 2,7 millions de morts du covid19 en pantoufles devant son écran.

                Bon , il commence par la France et manifestement il a rien trouvé d’anormal. Tout est donc logique dans son petit monde tant qu’il ne se rend pas dans les hôpitaux pour débusquer tous les faux malades...

                C’est la cohérence de celui qui dénie. Allez faire un tour sous son dernier papier, il n’arrête pas d’appeler à la discussion tous les agoranautes qu’il a arbitrairement banni et censuré et qui ne peuvent donc plus lui répondre.

                Très cohérent, donc, mais dans son système symptomatique ! smiley


              • Réflexions du Miroir Réflexions du Miroir 22 mars 19:14

                @Philippe Huysmans, Complotologue
                 En fait j’en sais rien, j’écris souvent en trois langues.
                 Avec le bruxellois en plus cela devient du melting pot..
                 T’as écouté au moins l’extrait ? Il t’étais destiné.


              • Réflexions du Miroir Réflexions du Miroir 22 mars 19:15

                @Réflexions du Miroir,
                 T’as vu, l’erreur ?
                 « Il t’étais destiné ».
                 Tu vois ça me reprend parfois... et personne le remarque.... smiley  smiley smiley
                   


              • @Réflexions du Miroir

                T’as écouté au moins l’extrait ? Il t’étais destiné.


                Sérieux ? C’est d’une importance, ce que tu me dis là ! T’es bien sûr ? Je vais de ce pas en parler à mon cheval...


              • Réflexions du Miroir Réflexions du Miroir 22 mars 19:21

                @The White Rabbit,
                 Mais, il faut dire, le pauv’ a parfois une bonté envers les autres....
                 Il a légué son vaccin (ainsi que ceux de sa famille) à d’autres. Il faut dire qu’il est altruiste jusqu’au bout des ongles.
                 Je le remercie parfois, aussi.
                 Jeudi, je reçois le mien.
                 Je suis parmi les bannis de ses égotistes écritures...
                 Mais, il en sort quelques fois comme si sa vague de conneries ne parvient pas encore à lui suffire.
                 J’en ai connu tellement de ces oiseaux rares pendant ma vie active, qu’aujourd’hui, ils ne me touchent même pas.
                 Ce sont des asymptomatiques. Ils n’en peuvent rien mais ils le font savoir. 
                 
                 


              • Réflexions du Miroir Réflexions du Miroir 22 mars 19:23

                @Philippe Huysmans, Complotologue
                 Bonne idée. Ton cheval comprendra peut-être mieux que tu le fais.
                 Mais je suis pas sûr que tu peux te comparer à l’homme qui parlait à l’oreille d’un cheval.
                 Fais gaffe, il pourrait ruer. 


              • @Réflexions du Miroir

                Désolé, tonton, mais tu écris de telles conneries que ne pas te le faire remarquer relèverait de la non assistance à personne en délire.

                Et moi je suis altruiste smiley


              • @The White Rabbit

                Bon , il commence par la France et manifestement il a rien trouvé d’anormal.


                J’ai bien cherché, tu sais, le problème c’est qu’il n’y a vraiment, vraiment rien de spécial qui se serait passé en 2020. Je sais que ça te fait un peu de peine, mais c’est comme ça.

                Allez faire un tour sous son dernier papier, il n’arrête pas d’appeler à la discussion tous les agoranautes qu’il a arbitrairement banni et censuré et qui ne peuvent donc plus lui répondre.


                Non je me contentais de faire remarquer que d’être bannis ne vous a jamais empêché de couiner très fort. Tu viens encore de le démontrer.


              • Réflexions du Miroir Réflexions du Miroir 22 mars 19:28

                @Philippe Huysmans, Complotologue
                  Je t’ai appelé pour les lire.
                  Alors faut pas croire que je ne tiens pas compte des personnes en danger.
                 Je suis là, je te tiendrai la main en virtuel si tu veux.
                 Il faut toujours venir au secours des personnes qui ne savent pas ce qu’elles racontent. 


              • Réflexions du Miroir Réflexions du Miroir 22 mars 19:29

                Allez, je te laisse, ma poule...
                Cocotte bien sans moi.
                J’ai d’autres choses à faire et puis tu es un pollueur de cet article et de son auteur.
                @+ pour de nouvelles aventures...


              • Bendidon Bendidon 22 mars 19:58

                @The White Rabbit
                coucou le banni LOL MDR smiley


              • Réflexions du Miroir Réflexions du Miroir 22 mars 20:24

                @Bendidon
                 Petit retour avant d’aller dormir sur mes pensées et mes rêves.
                 Ce 22 mars est le 5ème anniversaire des attentats donc vous avez été touchés un peu plus tôt.
                 Qui est touché par les attentats des humains et des virus et qui peuvent en parler ?
                 Ceux qui sont dans les cliniques et ce matin il y avait un témoignage de l’une d’elles. Les autyres ont un seul droit : se taire avec respect.
                 Chez moi, il n’y a personne de banni.
                 Je lis tout. Tout me sert. Ce ne sont pas les bravos qui m’intéressent.
                 J’aime être étonné par des événements
                 On n’apprend rien par ses semblables.
                Cette fois...
                Bonne nuit à tous.
                 smiley


              • SATURNE SATURNE 22 mars 17:05

                @Bernard Dugué

                Quelle importance, après tout, vu que comme vous l’écriviez ici même à moult reprises il y a un an, tout ceci n’est :

                « qu’une épidémie de peur » ( sic)

                _ une « grippette »

                PS : sérieusement, vous devriez aller vous cacher (sous votre couette ou ailleurs, mais pas ici...)



                  • joletaxi 22 mars 17:27

                    @Réflexions du Miroir

                    vaguement écouté... et puis une remarque d’un chercheur de Pasteur m’a fait sursauter, concernant ses travaux sur les phages :

                    quand j’ai commencé à évoquer ces thérapies, tous les médecins, chercheurs m’ont dit, c’est inutile, si cela marchait cela se saurait

                    exactement le même genre d’arguments servis ad nauseum à propos de l’utilité des traitements pour le covid

                    une thérapie ancienne, difficilement exploitable par big pharma, qui se heurte à la clique des mandarins, comme c’est curieux


                  • Réflexions du Miroir Réflexions du Miroir 22 mars 17:41

                    @joletaxi,
                     Ce que nous apporté cette épidémie ou pandémie, c’est la différence d’approche du problème par l’intermédiaire de deux manière pour créer les vaccins :
                     La manière ancienne et donc en principe la plus éprouvée : AstraZeneca, Janson & Johnson et CurVac par vecteur viral
                     La nouvelle manière : Pfizer-BionTech et Moderna par Vaccin ARN qui demande plus de précaution au niveau température de conservation.
                     Tout est calculé au niveau de l’efficacité.
                     Le nombre de prise est aussi un indice de différence.
                     Les vaccins russes et chinois, personne, n’en connait vraiment l’efficacité

                     


                  • Réflexions du Miroir Réflexions du Miroir 22 mars 17:43

                    Aujourd’hui, on travaille par modèle informatique avec l’IA et cela est aussi une différence énorme.


                  • Eric F Eric F 22 mars 18:48

                    L’hypothèse de la fuite accidentelle d’un virus de laboratoire a été évoquée assez tôt au début de l’épidémie, tout en étant présentée dans la plupart des publications scientifiques comme moins probable qu’une origine animale identique à la plupart des virus respiratoires récents. Néanmoins la « mission » de l’OMS en Chine a inspecté le laboratoire de Wuhan dans cette hypothèse, sans évidemment rien pouvoir conclure en absence de coopération locale- (rappelons au passage que Trump accusait l’OMS de « complaisance » envers la Chine).

                    L’absence de souche animale plus proche du SARS COV2 que le RATG13 de chauve souris de 2013 pose la question du ou des « chaînons manquants » sur lesquels porte l’article.
                    Il a été question récemment d’une autres souche de coronavirus proche du SARS COV2 au Cambodge, qui pourrait expliquer l’apparente préimmunisation des populations de la région. Des croisements entre ces « candidats ancêtres » ont-ils pu s’opérer naturellement ?

                    Sur un autre point, le scénario d’une diffusion intentionnelle d’un virus volontairement rendu virulent n’est pas plausible, car la Chine ne se serait pas autoinfectée au risque d’un désastre, ni les occidentaux n’auraient pas infecté la Chine sachant que le virus risquait de se propager sur tous les continents -ce qui s’est passé-. Un labo pour son propre compte afin de vendre ses futurs vaccins ? mais lequel, puisque Pasteur a foiré dans la mise au point d’un vaccin, « Bionetch » est une petite boite, etc.


                    • Bernard Dugué Bernard Dugué 22 mars 20:09

                      @Eric F
                      La souche du Cambodge est anecdotique. J’ai quand même mailé aux virologues ayant publié cette observation pour leur demander la séquence Spike. Ils n’ont pas répondu. Tout aussi anecdotique est la souche retrouvée au Japon, Rc-o319, proche du SARS-Cov-2 mais moins que RatG13. Il y a des chances que le chaînon manquant soit vraiment manquant. Les coronavirus se transforment avec des recombinaisons effectuées avec la complicité de l’hôte, ce qui laisse peu de chance pour trouver l’ancêtre zoonotique


                    • Eric F Eric F 23 mars 10:31

                      @Bernard Dugué
                      Ces souches montrent qu’il existait de la « famille proche » qui a éventuellement pu contribuer à ces recombinaisons, comme on le constate désormais entre certains « variants » du SARS Cov2.
                      On aimerait que tout ce processus évolutif converge vers une forme « bénigne » mais fortement transmissible qui se substitue aux autres, comme ce fut semble-t-il le cas pour l’ainsi nommée « grippe russe » de 1889, désormais présumée coronavirale plutôt que grippale.


                    • Bernard Dugué Bernard Dugué 23 mars 11:09

                      @Eric F L’évolution vers une forme plus « anodine » du virus a été envisagée par Bruno Lina. Ce qui fait de Lina un rassuriste. Le gros souci, c’est l’adaptation de la protéine S à son récepteur et les deux clés pour fusionner. Tant qu’il y aura ces deux clés, le virus risque d’être assez méchant. Mais chut, gardez cette info pour vous, on a assez de nouvelle anxiogènes pour ne pas en rajouter


                    • Eric F Eric F 23 mars 14:33

                      @Bernard Dugué
                      Merci de l’info. Jusqu’ici la réalité n’a pas été ni aussi catastrophique que ne prévoyaient les plus alarmistes, mais malheureusement pas aussi aussi bénigne que les rassuristes ne laissaient espérer. Jusqu’en Septembre dernier je voulais encore les croire, mais l’épidémie ne s’est pas éteinte, les « mutants » on relancé la roulette.

                      Au niveau des « mesures », on reste dans l’incohérence la plus totale, entre le vrai-faux confinement (interdit de quitter la région ...sauf la multitude qui l’ont fait entre l’annonce et la mise en oeuvre), les fermetures de magasins et dérogations dans la plus totale arbitraire (on peut s’acheter une bagnole mais pas une paire de chaussettes), et le vaccin Astra qui était il y a deux jours encore limité au moins de 55 ans en Espagne et au plus de 55 ans en France. Je ne veux définitivement pas de cette décoction ; étant dans la tranche d’âge désormais escamotée des 65-70, je me fais oublier (pourvu que mon généraliste ne téléphone pas), je verrai au seuil de l’été pour un vaccin ARNm à plus large spectre sur les variants et moindres effets immédiats nocifs (suite à étude des publications, je ne suis pas mytho sur les effets à long terme). D’ici là j’adhère à la nouvelle consigne de prendre l’air et le soleil et éviter les lieux de bousculade en espace clos -étant en milieu semi-rural, pas de difficulté-.


                    • Bernard Dugué Bernard Dugué 23 mars 18:41

                      @Eric F
                      Le vaccin Astra est composé d’un vecteur à ADN qui pourrait activer l’immunité innée et créer des soucis en cas de suréaction. C’est sans doute pour cela que les thromboses rares surviennent chez des patients plus jeunes. 


                    • Eric F Eric F 24 mars 13:50

                      @Bernard Dugué
                      Le vaccin Astrazénéca « à vecteur viral » -tout comme le Sputnik russe- est moins novateur donc était supposé moins « à risque » que les vaccins à ARNm qui ont fait l’objet initialement de craintes et de réserves y compris parmi des experts « institutionnels ».
                      Mais au bout de quelques mois, la réputation s’est inversée pour diverses raisons (moindre efficacité sur certains variants, effets secondaires plus prononcés...). Les soignants n’en veulent plus pour eux-mêmes, les âges d’application sont intervertis, à quoi s’ajoutent les retards de livraison et indices de lots avariés...

                      donc malgré des résultats favorables d’efficacité au Royaume Uni, la méfiance s’est instaurée dans beaucoup de pays. On a presque l’impression de se faire refiler un produit laissé pour compte.


                    • Christophe Claudel Christophe Claudel 23 mars 10:44

                      La théorie de la transmission « zoonose » du coronavirus (de l’animal à l’humain) est un classique de la littérature scientifique s’agissant des nouvelles épidémies. Mais qui fait rarement l’unanimité des chercheurs. Pour ce qui est du Covid, elle pourrait venir s’ajouter aux œuvres de La Fontaine sous le titre d’une nouvelle fable intitulée « Le pangolin, la chauve-souris et le petit Mandarin ». Une farce tellement échevelée, digne des pires machins complotistes, que plus aucun scientifique sérieux n’ose aujourd’hui l’évoquer, de peur de se ridiculiser.

                      Plus personne en effet dans le milieu scientifique comme dans les médias ne se risque depuis bientôt un an à évoquer le sujet et à spéculer sur l’origine de ce virus mystérieux, pourtant observé sous toutes les coutures et disséqué en menus morceaux depuis son apparition en Chine à l’été 2019. Un sujet devenu très vite un tabou dans tous les médias mainstream, dès l’extension « pandémique » du virus hors des frontières de la province de Wuhan fin 2019. Silence radio, mieux valait assommer le grand public de commentaires alarmistes en diffusant en boucle les images de Wuhan en état de siège. Et ce bien que le sujet soulève de nombreuses questions à propos de cette grippe dont la cause était unanimement présentée comme un nouveau virus transmis à homme par un innocent fourmiller dont la viande est couramment consommée en Chine. Une grippe présentant dans ses formes les plus graves des symptômes respiratoires sévères et aussitôt transformée en pandémie du siècle.

                       

                      D’un coronavirus somme toute banal, on est ainsi passé à un « paranovirus », dont le mode de contamination n’était plus les mains mal lavées ou l’air ambiant (encore une fable…) mais les médias entrés en éruption sismique. Un scénario de psychose mondiale provoqué à dessein par quelques lobbies qui y avaient intérêt. Une reproduction en grandeur XXL et en beaucoup plus dramatique de celui qu’on nous avait déjà servi en 2009 lors de l’apparition d’un foyer de grippe H1N1 au Mexique. Un virus qui avait immédiatement enflammé les esprits et les écrans plus que les thermomètres, et ce durant près d’un an. Assurant au passage à Gilead Science (déjà...) la vente très profitable aux gouvernements affolés de la planète de milliards d’unités de vaccin et de Tamiflu, tous aussi inutiles, toxiques et inefficaces que le remdésivir que le même labo a tenté de nous refourguer en 2020 en corrompant au passage les plus grands scientifiques, les gouvernements, les agences de santé et le Lancet, pour couler son principal concurrent l’hydroxychloroquine ! 100 millions de doses de vaccin furent ainsi achetée en 2010 par le gouvernement de Nicolas Sarkozy, lesquelles finirent quasiment toutes à la poubelle, non sans avoir coûté au passage près d’un milliard d’euros au contribuable français.

                      Même scénario avec le Covid-19 et les petits arrangements entre Macron et ses généreux mécènes pharmaceutiques. Sauf que cette fois le jackpot a fait exploser la banque, la dette de la France, plusieurs secteurs économiques, et la tête des Français.

                      Mais revenons à la fable du pangolin...

                      Depuis 2019, les preuves se sont tellement accumulées pour étayer l’hypothèse troublante d’un virus créé artificiellement par l’homme en laboratoire par manipulations génétiques, que même les épidémiologistes et les « experts » autoproclamés les plus corrompus habitués des plateaux télé sont aujourd’hui à court d’arguments sérieux pour étayer la thèse initiale du pangolin. Un pangolin qui figurait pourtant en bonne place sur la couverture du magazine britannique (détenu par les Rothschild) The Economist, dont le très attendu hors-série annuel consacré à l’année suivant mettait en scène fin 2018 et pour l’année 2019 un étrange pangolin glissé au milieu d’autres symboles tout aussi étranges : fragment d’ADN, smartphone (5G), code-barre, etc... Et ce plus de 6 mois avant l’apparition de l’épidémie en Chine.

                      Le premier en France à avoir enfoncé la digue de la langue de bois à propos de l’origine du coronavirus fut bien entendu le Professeur Luc Montagnier. Célèbre immunologue, empêcheur de tourner en rond, Prix Nobel de médecine et codécouvreur du virus du sida. Lequel n’en était pas à son coup d’essai s’agissant de révélations sulfureuses. Le vieux professeur un brin narquois avait alors jeté un vent polaire en direct sur le plateau de Cnews. Interrogé par Pascal Praud sur l’origine du coronavirus, il avait en effet révélé une découverte stupéfiante de son équipe de recherche : le séquençage du génome du virus SARS-Cov-2 responsable du Covid-19 et son analyse par algorithmes informatiques avaient fourni la preuve irréfutable que ce virus ne pouvait être d’origine naturelle. En effet le génome du SARS-Cov-2, responsable du Covid-19, présente plusieurs « insertions » dont un petit fragment du génome du VIH, rétrovirus responsable du sida. De telles insertions ne peuvent avoir être réalisées qu’en laboratoire ; elles ne peuvent scientifiquement être le résultat d’une mutation ou d’une anomalie génétique d’origine naturelle liée à une quelconque transmission de l’animal à l’homme. Ce type de manipulations est d’ailleurs souvent réalisé par les chercheurs en génie génétique. Notamment dans l’espoir de mettre au point de nouveaux vaccins. Une technique employée depuis des décennies pour tenter de créer un vaccin efficace contre le VIH, en utilisant des composantes de virus courants type coronavirus, et en y insérant un fragment de l’enveloppe du VIH reconnus par les récepteurs des lymphocytes, de façon à produire une réponse immunitaire dirigée contre le VIH en cas d’infection, une fois ce vaccin injecté dans le corps humain.

                      Le Pr. Montagnier ne fut évidemment pas le seul à larguer une telle bombe. De nombreux scientifiques et équipes de recherche de renom avant et après lui ont également publié les résultats de leurs travaux dans des revues scientifiques mettant en avant les preuves de cette origine humaine du virus. Au point qu’elle apparaît aujourd’hui difficilement contestable. Même des médias officiels comme France l’ont d’ailleurs récemment évoqué comme une hypothèse plausible, levant un voile pudique sur les questions dérangeantes qu’elle soulève : pourquoi cette hypothèse n’a pas été évoquée avant ? Comment le virus a-t-il pu être disséminé depuis un laboratoire de recherche p4 situé à Wuhan : par accident ? Intentionnellement ? Et si oui à quelles fins ?... La France était-elle effectivement impliquée dans la gestion de ce laboratoire de Wuhan ? A quel titre ? Participait-elle aux recherches qui y étaient menées ? Se pourrait-il aussi qu’elle soit impliquée dans cet « accident ». Et pourquoi les autorités chinoises ou françaises n’en auraient-elles rien dit ?

                      Le spectre de Tchernobyl plane sur ce qui pourrait devenir le plus grand scandale sanitaire du 21e siècle, après le précédent quoi en a connus beaucoup.


                      • Eric F Eric F 23 mars 14:50

                        @Christophe Claudel
                        Si nos labos hexagonaux avaient été « mouillés » dans une genèse artificielle de ce virus, ils auraient été les premier à proposer un vaccin. Mais ils ont un bon alibi (si ont peut dire) : ils ont lamentablement échoué dans ce domaine, et autant concernant les tests et antiviraux ciblés.

                        Un hypothétique vaccin contre le VIH n’utiliserait en aucun cas comme virus vecteur un membre de la pernicieuse famille coronavirale. Mais, tout comme deux voitures ont en commun d’avoir 4 roues, deux virus lointains peuvent avoir en commun certaines séquences identiques.

                        Tchernobyl est un accident technique sérieux, mais n’a pas conduit à une hécatombe pas plus que Fukushima. Le (la) covid a fait bien davantage de victimes sans être non plus une épouvantable hécatombe, ce qui restera dans l’histoire c’est la surréaction et l’incohérence des mesures prises.


                      • Christophe Claudel Christophe Claudel 23 mars 10:44

                        [suite et fin]

                        Ces révélations, d’abord vite évacuées comme des « thèses complotistes » (le Pr. Montagnier fut accusé d’être un « complotiste gâteux » et ses travaux furent aussitôt discrédités et censurés dans les médias et sur les réseaux sociaux comme Facebook) ressemblent en tout cas à astéroïde géocroiseur qui vient périodiquement menacer la mare aux canards et autres médias alignés sur la doxa scientifique et médiatique officielle. Pour laquelle le coronavirus responsable du Covid, comme tous les autres coronavirus récents, ne peut être que le fruit d’un accident de la nature, une mutation observée lors de sa transmission zoonotique à l’homme : pangolin, chauve-souris, oie sauvage ou autre. Un scénario bien huilé et resservi de nombreuses fois à propos de plusieurs épidémies précédentes plus ou moins dangereuses ou létales, et réputées dues à une transmission zoonotique : grippe aviaire, grippe H1N1, SRAS, MERS, etc... La plupart de ces grippes à coronavirus étant supposées suivre peu ou prou le même modèle, même si cette hypothèse est remise en cause.

                        Une façon au passage de battre sa coulpe, puisque l’homme est accusé d’être responsable de ces déséquilibres qu’il cause au milieu animal en mettant en péril les grands équilibres écologiques et zoologiques de la planète pas une surproduction, une surconsommation, notamment de viande animale, la déforestation, la destruction des milieux naturels et le déplacement d’espèces animales qu’elles entraînent, exposant dangereusement les villes et les populations au risque de transmission de nouveaux virus véhiculés par certains animaux sauvages. Les sanglots de l’homme blanc en version Avatar

                        En pointant ainsi la responsabilité de l’homme à propos des mutations génétiques qui engendrent de nouveau virus et des maladies parfois mortelles qui mettent en péril sa santé, on entretient parmi les populations touchées une culpabilité bien utile pour leur imposer ensuite toutes sortes de maltraitements : matraquages médiatiques anxiogènes (l’un des outils de l’ingénierie sociale depuis un siècle), surveillance renforcée, isolement des individus suspects, distanciation sociale, port permanent de la muselière réglementaire, internement à domicile, ou dans de centres de confinement créés pour l’occasion, tests à répétition aussi inutiles qu’inefficaces (mais très rentables), servant à justifier des 2e, 3e ou nième « vagues » imaginaires qui laissent s’étouffer les épidémiologistes sérieux, elles-mêmes servant à justifier des reconfinements et couvre-feux sans fin, les fermetures arbitraires et totalement inutiles de lieux publics, restaurants, salles de sports, de spectacle et autres lieux récréatives qui eussent permis d’alléger le poids des mesures sanitaires, de la déprime générale et de la destruction des économies et des personnes jetées à la rue ou l’extrême pauvreté. Des mesures multipliées jusqu’à exaspérer les populations afin de les contraindre aller se faire tester, vacciner, revacciner, de se faire tracer par des applis de flicage numérique, de signer des attestations absurdes, de se munir d’un passeport santé, demain (ou dès aujourd’hui si l’on en croit Bill Gates) inclus dans les vaccins eux-mêmes grâce aux « smart dusts », puis d’être pucés et encore plus surveillés, de renoncer une à une à toutes leurs libertés.

                         

                        Tout ça pour servir les intérêts des actionnaires de quelques labos cyniques et criminels. Et ceux des multinationales qui profitent de la redistribution économique et financière (le fameux Great Reset de Klaus Schwab) provoquée par ce choc épidémique.

                        Le pauvre petit pangolin a bon dos ! Comme toutes ces savantes théories scientifiques qui nous expliquent par le menu détail à propos des mécanismes de mutation génétique comment ce méchant coronavirus serait « apparu ». Face à toutes ces magouilles, ces crimes contre l’humanité et le bon sens, ce cynisme et cette obstination à nous rabaisser au rang chair à pâté pour chien de milliardaire.

                        L’éthique scientifique, médicale et pharmaceutique, mais aussi politique et médiatique, a du plomb dans l’aile : de nombreux acteurs scientifiques de premier plan comme Raoult, Perronne, Toussaint Toubiana, Fouché, ne cessent de le rappeler de semaines en semaines depuis un an et plus. Et derrière ces exemples flagrants de corruption manifeste se cache d’autres responsabilités : celles de scientifiques qui n’ont pas le courage ou l’intelligence de remettre en cause des théories qu’ils prennent pour acquises. En croyant toujours comme les foules ignares aux mythes de « l’objectivité », de la « rationalité » ou de la « vérité scientifique ».


                        • tashrin 23 mars 12:00

                          Mouais

                          Les explications les plus simples étant souvent les plus logiques...

                          Le consensus semble de plus en plus se former sur l’hypothèse d’une origine humaine consécutive à une fuite d’un labo de Wuhan analysant des échantillons provenant d’une region distante de plusieurs centaines de kilometres (la fameuse mine dans laquelle les mineurs sont morts il y a plusieurs années du fait d’un virus extremement proche et dont les autorités chinoises ont interdit l’accès depuis...)

                          Le Pangolin semble completement étranger


                          • Eric F Eric F 23 mars 14:55

                            @tashrin
                            « Le consensus semble de plus en plus se former sur l’hypothèse d’une origine humaine consécutive à une fuite d’un labo de Wuhan »
                            Pas de « consensus » en ce sens, l’hypothèse n’est pas exclue mais reste minoritaire hormis dans les courants « réfractaires ».


                          • tashrin 25 mars 12:19

                            @Eric F
                            non, ca n’est pas réservé aux complotistes, sauf à traiter Envoyé special et l’OMS de complotiste. 


                          • Bernard Dugué Bernard Dugué 23 mars 15:53

                            Un premier départ de feu en septembre 2019 ?

                             Et la crise sanitaire lui offre l’occasion de pointer les dérives de la Chine. « Un scientifique a établi qu’on a décelé des traces de la maladie en septembre 2019 ! Si les autorités avaient averti l’OMS, peut-être que la situation aurait été différente. Il aura fallu un an et 2,5 millions de victimes avant qu’ils acceptent la présence d’enquêteurs », s’insurge le plasticien.

                            https://www.lefigaro.fr/cinema/pour-ai-weiwei-les-dirigeants-chinois-savaient-ce-qui-se-passait-a-wuhan-mais-ont-dissimule-la-verite-20210322


                            • Eric F Eric F 23 mars 17:57

                              @Bernard Dugué
                              Les dissidents chinois et les officiels occidentaux accusent la Chine
                              Les dissidents occidentaux et les officiels chinois accusent l’Occident
                              La chauve souris accuse le Pangolin
                              Le pangolin accuse la chauve souris
                              et Q annone que c’est big pharma....


                            • Baba Yaga Baba Yaga 24 mars 09:47

                              C’est bizarre comme tout le monde se précipite pour désigner la Chine comme coupable ! L’ennemi économique des Usa et leur valet l’Europe, est tout prêt a les faire accuser parce que ce serait parti de là bas ??

                              Rien n’est moins sur, la Chine a déjà eu affaire aux « virus, maladies, lors de la guerre de Corée en 1955, raison pour laquelle, ils sont très prêts de croire en une énorme manipulation venant des Usa le pays de loin le plus prolifique, sur les bio-armes ou créations de virus avec les Gains de Fonction ..

                              Lors des années 2013 a 2017 il y a eu polémique sur les moyens de créer des chimères » ou nouveaux virus dangereux appelés Frenkeistein virus .Une faible mobilisation de l’opinion publique | Le « Frankenvirus » H5N1 (psl.eu)

                              .Suivez les lignes sur ce site, qui s’en est i émeut ..et pourtant il se pourrait qu’en guerre économique contre la Chine, certains pays, prétendant collaborer avec eux aient les moyens de préparer une bombinette afin de « casser » l’économie gagnante de cet immense pays. https://varuncnmicro.blogspot.com/.../ferrets-are-not... Un moratoire avait été imposé mais les chercheurs ont fait sauter le moratoire « pour continuer » avec l’aide des Gains de Fonction« et la méthode CRISPsCas9 les ciseaux génétiques..........la Chine a bon dos !!


                              Car l’animal qui fait le pont entre l’animal et l’humain, c’est le furet (Raoult dit vison car ils sont de la même espèce) Régulièrement les virus en question s’échappent, aux Usa même de leurs labos (hasard ou accidents ?) http://www.piecesetmaindoeuvre.com/.../Nouvel_ennemi_2_.pdf Le CRSSA, Fort Detrick et les États contre le bioterrorisme !! 

                              ..The consequences of a lab escape of a potential pandemic pathogen (nih.gov) 

                              https://armscontrolcenter.org/wp-content/uploads/2016/02/Escaped-Viruses-final-2-17-14-copy.pdf?f 

                              Juste avant la crise de Wuhan, le célèbre laboratoire de Fort Detrick a dû fermer a cause de »fuites« de ces fameux virus, ce que les chinois savent et ils demandent des explications aux américains. Car il y aurait eu des malades aux Usa bien avant, d’une curieuse pneumopathie déceler pas très loin de l’endroit, et qui s’est répandu .

                              Raoult a parlé des »visons" qui seraient la source dans sa dernière vidéo.Virus mutants : les furets de la discorde (lemonde.fr) 

                              Diverses maladies pneumopathies et la maladie exceptionnelle dite du Vapotage EVALI, dans des homes et maisons de retraites,

                               Investigation COVID19 : la remarquable (et peut-être...) fortuite coïncidence ! | Le Club de Mediapart

                              New data leak from the Pentagon biolaboratory in Georgia - Dilyana.bg






Ajouter une réaction

Pour réagir, identifiez-vous avec votre login / mot de passe, en haut à droite de cette page

Si vous n'avez pas de login / mot de passe, vous devez vous inscrire ici.


FAIRE UN DON



Publicité



Les thématiques de l'article


Palmarès



Publicité