• AgoraVox sur Twitter
  • RSS
  • Agoravox TV
  • Agoravox Mobile

Accueil du site > Actualités > Technologies > Le SARS-CoV-2 a-t-il été fabriqué en laboratoire ? Eléments pour (...)

Le SARS-CoV-2 a-t-il été fabriqué en laboratoire ? Eléments pour répondre

PNG

 D’où vient le SARS-CoV-2 ? Cette question aurait pu aussi se poser pour le SARS de 2003 qui fut éradiqué parce que seuls les patients atteints du syndrome respiratoire étaient contagieux. J’ai fait ma propre enquête en privilégiant certains caractères de ce virus. Quelques-unes des analyses présentées sont inédites et ne figurent pas dans des publications scientifiques.

 

 1) Les coronavirus

 Les coronavirus sont des particules composée d’un génome à ARN de quelque 30 000 bases, associé à une enveloppe virale composée de trois types protéiques, M pour membrane, E pour enveloppe et S pour spicule. L’ARN est associé à la protéine N et forme une nucléocapside. Cette protéine N joue un rôle important lorsque le génome entre dans une cellule. A ces quatre protéines dites structurales s’ajoutent 16 protéines non structurales, codées sur les deux premiers tiers du génome (ORF1a,b), parmi lesquelles la nsp12 est une polymérase permettant de répliquer le génome. Pour finir, il y a aussi des protéines dites accessoires, codées sur des séquences de lecture vers la fin du génome. Les coronavirus se scindent en quatre types, alpha, bêta, delta, gamma. Les deux premiers auraient comme réservoir d’origine la chauve-souris ; ils infectent une série de mammifères ainsi que les humains. Les types delta et gamma auraient comme origine les oiseaux ; ils infectent en plus les bovins. Ces coronavirus sont en fait endémiques, présents dans un réservoir comprenant une ou plusieurs espèces. La distinction endémique épidémique n’est pas scientifique mais pratique. Ce n’est pas le virus qui est épidémique mais la cinétique de propagation et l’étendue des pathologies en résultant. Le SARS-CoV-2 est actuellement épidémique, comme l’est le coronavirus décimant les élevages porcins en causant la diarrhée ou alors les coronavirus détectés dans les élevages canins et causant eux aussi pas mal de dégâts.

 

 2) Les coronavirus humains

 Quatre coronavirus occasionnent des rhumes et quelques fois des infections dans la trachée ou les bronches sans occasionner de problème sanitaire important. Deux sont connus depuis les années 1960 et deux autres ont été identifiés dans les années 2000, ce qui ne signifie pas qu’ils soient apparus à cette date. C’est juste que les scientifiques ont porté une attention plus soutenue à ces virus depuis la crise épidémique causée par le SARS de 2003. Puis le MERS a été détecté en 2013 et enfin le SARS-2 en 2019. Les médias ont focalisé l’attention sur la protéine S et son domaine de liaison au récepteur ACE2, un domaine assez variable, pouvant muter et produire des variants censés être plus contagieux, voire capables d’échapper aux vaccins puisque ce domaine situé en position proéminente contient des motifs antigéniques (épitopes) déterminant la réponse humorale. En revanche, il n’y a pas de lien solide entre la virulence et la liaison ACE2. Le HCoV-MERS n’utilise pas le récepteur ACE2 et pourtant il est très méchant ; le HCoV-NL63 utilise le récepteur ACE2 et pourtant il n’est pas vraiment virulent. Pour connaître les causes virologiques du Covid-19, il faut chercher ailleurs

 

 3 L’étrange protéine Spike

 La protéine S est composée de deux sous-unités. La première contient le domaine de liaison (RND) pour ACE2 ; la seconde contient le domaine FP, situé près du second site de clivage. Ce domaine permet la fusion et l’entrée du virion, avec les autres domaines, les heptades, HR1, HR2, le domaine transmembranaire, TM et l’endo-domaine, E. Cette partie composite assure la translocation du virion dont le génome traverse le cytoplasme en direction de l’appareil ribosomal.

 

= NTD==RBD==SD1=SD2 = S1↓S2==FP=HR1=HR2=TM=E=C-term

===== sous-unité S1 = /S1↓S2 / ==== ↓ S2’ === sous unité S2 =====

 

 Le domaine de fusion FP est conservé sur la plupart des coronavirus. Le premier site de clivage S1/S2 est absent sur la protéine S du SARS-CoV. En revanche, la séquence situé sur la sous-unité S2 juste après le second clivage S2’ est conservée avec une précision remarquable. Elle contient le peptide de fusion FP.

 

 4) Le code trypsine et les sarbecovirus

 Les deux coronavirus ayant causé les syndromes pneumoniques aigus chez l’homme ont une origine animale. Les signatures protéiques en attestent. Je n’utilise pas les séquences génétiques pour étudier les similitudes. Une nouvelle tendance en virologie suggère de classer les virus à partir des familles de protéines. Je vais plus loin en cherchant des motifs protéiques conservés et traduisant les gains de fonction des virus. Des courtes séquences apparaissent déterminantes pour chaque étape fonctionnelle du virus et certains motifs ressemblent à des codes pour naviguer et opérer dans le tropisme intracellulaire. Examinons ces deux séquences de la protéine S récupérées sur un virus SARS-1 de 2003 et un SARS-2 de 2020 :

 

SARS-CoV-ZJ0301 ; GenBank : ABA02260.1 (2003)

781 __gfnfsqilpdplkptkr↓sfiedllfnkvtladagfmkqygeclgdinardlicaqkfngl

 

SARS-CoV-2 ; GenBank : QIG55857.1 (2020)

801 __nfsqilpdpskpskr↓sfiedllfnkvtladagfikqygdclgdiaardlicaqkfngltv

 

 On observe une conservation parfaite d’un peptide de quelque 30 acides aminés au milieu duquel se trouve un motif polybasique (avec k et r). Il s’agit du peptide de fusion qui permet en quelque sorte au virion de s’accrocher au sas membranaire alors que le motif central est une sorte de code reconnu par la trypsine et qui permet au virion d’entrer dans la cellule. Ce code n’est pas le même. Le code lkptkr a été trouvé sur des virus infectant les chauves-souris ainsi qu’un bon nombre de variants extraits de civette palmée. Le code skprkrs est en revanche propre à un réservoir incluant les chauves-souris et les pangolins (trouvé sur des dizaines de génomes). Ces deux codes sont spécifiques des variants ou souches appartenant à la sous-famille des sarbecovirus (incluse dans la famille bêta) On ne les retrouve pas sur d’autres coronavirus, par exemple le A515 qui infecte les chauves-souris et appartient la famille alpha. Ce code skprkrs est présent sur la souche controversée RaTG13 récupérée en 2013 sur une chauve-souris mais séquencée en 2020. On le trouve aussi sur la souche Rc-0319 récupérée en 2013 au Japon et séquencée elle aussi en 2020.

 Ces données penchent en faveur d’une origine animale du SARS-CoV-2 et plus exactement, un franchissement de la barrière inter-espèces du sous-clade pangolins et chauve-souris de 2013 (Le SARS-1 provient du sous-clade de 2002 civette et chauve-souris). Le classement phylogénétique des virus n’en reste pas moins approximatif et incertain, contrairement à la phylogenèse des espèces. Qui définit un clade en virologie ? Le génome, le réservoir ou alors les codes et fonctions ? Dans le cas des codes et des réservoirs, on peut assigner le SARS-1 au clade Sarb-2000 et le SARS-2 au clade Sarb-2010. Pour passer de l’un à l’autre on soustrait la civette, on ajoute le pangolin et on change le code trypsine. Des virologues français viennent d’annoncer la découverte de deux variants appartenant à ce réservoir et récupérés en 2010 au Cambodge sur des chauves-souris. 

 

 5) L’étrange code furine

 La protéine S du SARS-CoV-2 a la particularité de disposer d’un code que l’on ne trouve pas sur le SARS de 2003. Ce code permet un clivage par la furine. Il est soupçonné d’avoir rendu fortement pathogène le coronavirus de 2019. Ce gain de fonction est un classique, observé sur d’autres virus. Le lien entre les codes polybasiques et la virulence des souches grippales est établi par des dizaines d’observations sans pour autant être une règle universelle. Les virus de la grippe aviaire hautement pathogènes avec les sous-types d'hémagglutinine (HA) H5 et H7 évoluent à partir de précurseurs faiblement pathogènes par l'acquisition de plusieurs résidus d'acides aminés basiques permettant le clivage de l’HA.

 

La séquence en question se présente ainsi :

671 casyqtqtnsprrar↓svasqsiiaytmslgaensvaysnnsiaiptnfti

 

 C’est ce motif sprrars qui a nourri les thèses sur une origine artificielle du virus qui aurait été bricolé à partir d’un sarbecovirus de chauve-souris, voire de pangolin, en insérant une courte séquence nucléotidique permettant la production du code furine sur la protéine S. Le problème, c’est que le SARS-CoV-2 diverge de plus de 4% par rapport à la souche la plus proche, la RaTG13, et encore plus des autres souches appartenant au sous-clade Sarb-2010.

 

 6) Nucléocapside

 Si l’attention a été focalisée sur ma protéine S, la nucléocapside qui s’associe au génome est tout aussi importante. La protéine N de la nucléocapside possède plusieurs motifs polybasiques ainsi qu’un domaine riche en sérine, pouvant être phosphorylé ; et qui a une importance fonctionnelle précise. Voici la protéine N complète :

 

IDR — (RNA binding) — (SR rich LRK) — (RNA binding NLS) — IDR

1_____44__________182_____________247____________366___422

 

 Et maintenant observons le domaine riche en sérine qui est extrêmement conservé, du SARS-1 au SARS-2 en passant par d’autres variants comme le Rc-o319 de la chauve-souris japonaise isolée en 2013. De part et d’autre du peptide enrichi en sérine nous voyons également une conservation très importante. Ces détails indiquent clairement la signature et la marque de fabrique du coronavirus de Wuhan responsable de la pandémie de Covid-19 :

 

SARS-CoV

152 pnnnaatvlqlpqgttlpkgfyaegsrggsqassrsssrsrgnsrnstpgssrgnsparmasggg

SARS-CoV-2

152 pannaaivlqlpqgttlpkgfyaegsrggsqassrsssrsrnssrnstpgssrgtsparmagnggd

Bat Rc-o319

152 pannaaivlqlpqgttlpkgfyaegsrggsqassrsssrsrgssrnttpgssrgnsparsvgngg

 

 7) La protéine accessoire ORF6

 Une troisième protéine mérite une attention, c’est la protéine dite accessoire ORF6. Que l’on ne confondra pas avec la protéine non structurale nsp6 qui elle, est codée sur la longue séquence de lecture ORF1a,b. Cette protéine codée par la séquence de lecture numérotée en 6 serait responsable d’une interférence avec la voie de signalisation JAK/STAT qui règle la balance entre immunité et inflammation. ORF6 produit une suractivation de STAT3 qui avec les cascades inflammatoires explique les formes graves du Covid. Cette petite protéine de quelque 60 résidus est elle aussi très conservée. On retrouve la signature du réservoir de 2013 d’où est issu le coronavirus de Wuhan, autrement dit le clade Sarb-2010. Cette séquence ORF6 est très conservée, y compris dans la souche japonaise, ce qui laisse penser que ORF6 n’est pas si accessoire que sa dénomination ne l’indique :

 

SARS-CoV-2 (2020)

mfhlvdfqvt iaeilliimr tfkvsiwnld yiinliiknl sksltenkys qldeeqpmei d

Rc-o319, GenBank : BCG66631.1 (2020)

mfhlvdfqit iaeilmmimr tfkvsilnld yiisvivrhl sksltenkys qldeeqpmet d 

Pangolin GenBank : QIG55949.1 (2020)

mfhlvdfqvt iaeilliimr tfkvsiwnld yiinliiksl skpltenkys qldeeqpmei d

 

 8) La signature S1 du SARS-CoV-2 et le code furine

 Nous savons quelle est l’origine zoonotique du nouveau virus avec trois signatures permettant d’authentifier le clade, (i) sous-unité S2 et code trypsine, (ii) protéine N et domaine enrichi en sérine, (iii) protéine accessoire ORF6. D’autres signatures sont aisément identifiables. La virologie du SARS-CoV-2 s’est focalisée sur le site de clivage furine qui fait sa spécificité et ne se retrouve sur aucune souche du clade Sarb-2010, ni celui de 2000. La souche la plus proche est la RatG13. Nous pouvons superposer les résidus 660 à 720 et voir la similitude presque parfaite sauf l’insertion prra (un détail, la proline p est un acide aminé particulier capable d’interrompre des structures secondaires des protéines).

 

RaTG13

 

RaTG13 : ecdipigagicasyqtqtnsr↓svasqsiiaytmslgaensvaysnnsiaiptnftisvtt

SARS-2 : ecdipigagicasyqtqtnsprrar↓svasqsiiaytmslgaensvaysnnsiaiptnfti

 

 J’ai par ailleurs fait une recherche sur trois motifs plus ou moins étendus montrant des similitudes (repérées à l’œil nu). Ces trois motifs situés vers 500-600 sont présents dans le SARS de Wuhan et la souche RaTG13 et en supplément, quelques autres souches de chauves-souris ainsi que de pangolins que je note ainsi :

 

580 tleilditpcsfggvsvitp : quatre « Bat » dont YN2018A ajouté en septembre 2019 et neuf pangolins ajoutés depuis décembre 2019, donc avant le séquençage de Wuhan

558 flpfqqfgrdiadttdavrdpqtleilditpcsfggvsvitp : ce motif plus large qui contient le précédent est présent sur quatre souches de pangolins

605 snqvavlyqdvnctev : cet autre motif se retrouve sur neuf souches de pangolins. Vous noterez qu’y figure l’acide aminé D en position 614, promis à devenir G lors de la mutation D614G enregistrée dans les séquences et devenue dominante sur la planète.

 

En revanche, ces motifs ne se retrouvent pas sur la souche Rc-o319 récupérée au Japon en 2013. Ce détail penche en faveur d’une transmission zoonotique du virus localisée en Chine.

 

 9) Epilogue, d’où vient le SARS-CoV-2 ?

 Nous connaissons le clade d’où provient le coronavirus pandémique de Wuhan et la localisation en Chine des animaux ayant pu contaminer les humains. Il reste néanmoins deux problèmes. D’abord la souche originelle, qui ne correspond à aucune des souches séquencées. La RaTG13 est la plus proche mais elle diverge de 4%, ce qui constitue tout de même 1200 nucléotides. Pour info, les variants du coronavirus pandémique ayant le plus muté affichent au compteur une divergence de 40. L’origine suppose un chainon manquant, que l’on nomme SARS-X, proche du RaTG13, mais avec cette insertion de quatre résidus constituant le code furine, ce qui représente le second problème. Il n’y a qu’une alternative pour expliquer ce schéma :

 

SARS-X → → gain de fonction ; code furine → → SARS-CoV-2

 

 Première possibilité, la piste du laboratoire. Une souche SARS-X de corona aurait été utilisée pour réaliser une expérience ce gain de fonction, GOF, assortie ou non d’une insertion réalisée par génie génétique. Cette nouvelle souche serait sortie accidentellement du laboratoire, sans doute en contaminant un chercheur. Rappelons que le principe d’un labo P3 ou P4 est d’éviter de disséminer un agent pathogène dans la nature mais aussi de laisser sortir le chercheur pour qu’il retourne dans son foyer chaque jour.

 

 Deuxième possibilité, le SARS-X infecte un animal, chauve-souris ou pangolin, et se transmet vers un humain, sorte de patient zéro, hôte pouvant réaliser une expérience de gain de fonction naturel assorti d’une insertion du code furine. En réalité, la Nature ne fait que produire des gains ou des pertes de fonction en modifiant les souches et variants de virus.

 

Les deux hypothèses sont plausibles mais ne sont pas équiprobables. La fabrication d’un virus est un événement concevable mais l’accident de laboratoire est très peu probable. La piste naturelle est inverse, le gain de fonction reste énigmatique mais une transmission de virus n’a rien d’improbable et d’ailleurs, elle a été observée avec le SARS de 2002-2004. Chacun se fera son opinion. Pour ma part, je crois à la piste naturelle en notant cependant que le gain de fonction acquis par le SARS-X place la science face à une grande interrogation. La sélection darwinienne de virus dont le génome mute n’explique pas comment ce gain de fonction est soudainement apparu dans un « patient zéro » pour générer le coronavirus pandémique. Nous sommes encore loin de la compréhension moléculaire du vivant. La crise sanitaire doublée de l’énigme virologique devrait inciter la science à mener un effort conceptuel et théorique sans précédent, quitte à casser les cadres épistémologiques hérités des années 1960.

 

 10) Que peuvent faire les enquêteurs de l’OMS ?

 Si l’on retrouvait l’hypothétique SARS-X sur un animal, la piste naturelle deviendrait privilégiée pour ne pas dire certaine. Quant à la piste du laboratoire, en admettant qu’elle tienne la route, on se doute bien qu’il est facile pour les responsables de détruire toutes les preuves en effaçant les cahiers de labo, qu’ils soient en support papier ou dans les mémoires d’ordinateur.

 

___________________________________

 

Liens utiles

 

Coutard B. (…) Decroly E. ; The spike glycoprotein of the new coronavirus 2019-nCoV contains a furin-like cleavage site absent in CoV of the same clade ; Antiviral Res. 2020. 176

 https://dx.doi.org/10.1016%2Fj.antiviral.2020.104742

 

 Matsuyama, T., Kubli, S.P., Yoshinaga, S.K. et al. An aberrant STAT pathway is central to COVID-19. Cell Death Differ. 2020 27, 3209–3225. https://doi.org/10.1038/s41418-020-00633-7

 

NLMS

 https://www.news-medical.net/health/What-is-a-Polybasic-Cleavage-Site.aspx

 


Moyenne des avis sur cet article :  2.96/5   (27 votes)




Réagissez à l'article

84 réactions à cet article    


  • devphil30 devphil30 5 février 08:39

    Évidemment c’est limpide ....


    • Opposition contrôlée Opposition contrôlée 5 février 08:47

      vec une conclusion fracassante : « p’tet ben qu’oui, p’tet bon que non »


    • Séraphin Lampion Séraphin Lampion 5 février 08:53

      @Opposition contrôlée

      Jusqu’à ce qu’on sache comment la chose s’est faite, la seule chose réellement sûre, c’est que le système solaire s’est produit d’une certaine façon.


    • devphil30 devphil30 5 février 08:57

      @Séraphin Lampion

      Il faut toutefois tenir compte du coronacircus plus connu sous le nom usuel de

      ecdipigagicasyqtqtnsprrar↓svasqsiiaytmslgaensvaysnnsiaiptnfti

      J’ai recopié la ligne pour éviter une mauvaise interprétation du à une faute que j’aurais pu faire .... smiley


    • goc goc 5 février 12:20

      @devphil30
      oui mais du nord ou du sud ??


    • devphil30 devphil30 5 février 13:39

      @Opposition contrôlée

      A vous de conclure et de vous faire votre avis au vu des informations fournies .. smiley


    • devphil30 devphil30 5 février 13:40

      @goc

      Du sud car il a perdu le nord  smiley


    • eresse eresse 7 février 18:03

      @devphil30
      S’il s’agit d’un article de vulgarisation, une seule conclusion : C’EST RATE.


    • Bendidon Bendidon 5 février 09:54

      Bonjour Bernard, vous devriez renforcer votre article avec une vidéo sur votre chaine YT

      Un peu comme azyx1986 qui joint toujours une vidéo sur sa chaine Décoder l’éco (article du 2 février : la moisson des morts)

      Je n’ai pas les compétences pour interpréter le génome du Sars mais l’intuition me fait penser depuis le début que ce virus a été manipulé en labo. Il suffit d’ailleurs d’observer la hargne (pour ne pas dire la haine) des « toubibs » big pharma quand on ose aborder ce sujet !

      Tiens un récent article de France soir l’envisage :

      https://www.francesoir.fr/societe-sante/une-nouvelle-etude-du-dr-steven-quay-conclut-que-le-sras-cov-2-provient-dun

      Ce n’est pas un hasard si la sinistre Roselyne Bachelot veut interdire ce canard :

      c’est long mais ça vient

       smiley


      • Bernard Dugué Bernard Dugué 5 février 10:51

        @Bendidon
        L’article de Quay fait 200 pages. Je ne suis pas convaincu. Il met pas mal d’ardeur à démonter la réalité de la souche RaTG13 et se focalise sur le code furine. C’est de la virologie sérieuse mais je ne crois pas à l’analyse bayésienne pour ce genre d’investigation. Quay n’en est pas à son premier coup. Il a suggéré que la pandémie a son origine à l’hôpital militaire de Wuhan et se serait propagée avec la ligne 2 du métro
        https://zenodo.org/record/4119263#.YB0SwuhKjcs


      • Gasty Gasty 5 février 11:50

        Une autre vidéo : https://odysee.com/@coalition:0/L%27origine-du-SARS-Cov-2-enfin-r%C3%A9v%C3%A9l%C3%A9e—:8


      • HELIOS HELIOS 5 février 15:30

        @Bernard Dugué

        OOhhhh, bijou, hoooo (en tirant sur les renes du bourrin...

        Mr Dugué, votre article est fortement intéressant, mais dans un contexte tel qu’Agoravox, ce n’est pas un document ou un memoire scientifoco-technique que les lecteurs attendent  si ce n’est en annexe ou support d’un document de communication.

        Je ne remets pas en cause vos compétences, mais personnellement j’aurais aimé, quitte à synthetiser plus le message ou bien en allonger le texte, qu’il soit écrit en français.
        Il me semble que les phrases que vous avez employées déjà suffisament longues, aurait gagné en intérêt si les mots employés avaient perdu en précision... par exemple, :
        a la place de « clade » employez les mots « groupe de virus » ou tout simplement « coronavirus »

         la nucléocapside possède plusieurs motifs polybasiques ainsi qu’un domaine riche en sérine, pouvant être phosphorylé ...
        ...remplacez nucleocapside par « noyau du virus »
        ... motifs polybasique par« composition » basique ou « acide » lorsque c’est le cas
        ... serine remplacé une fois par « acide composant les virus » et les autres fois par « acides viraux », le fait qu’il soit jaune, on s’en fiche...dans ce contexte.
        ... phosphorylé ... « mis en evidence par des marqueurs luminescent »... au moins une fois et plus loin « marqués »...

        Cela dit, c’est certes difficile, mais vous faites de la vulgarisation, pas un cours d’université.

        Vous savez, la confiture et la tartine.... plus on ... etc, je l’ai pratiqué moi aussi, mais ce n’est pas un usage didactique, ni professionnels.

        Ne le prenez pas mal, c’est justement parce que j’aime vos interventions que je préférerais qu’elle soient plus... parlantes !


      • hervé06 6 février 17:52

        @Gasty
        Ce lien mène au teaser de Hold Up 2 (sortie prévue le 15/02), qui se penchera, entre autres, sur ces fameuses insertions d’acides aminés (séquence 680 du génome)... Ca a l’air très intéressant, et l’intervenant être de grande qualité quant à sa connaissance et sa maîtrise du sujet.
        Aller sur votre lien m’a permis de découvrir, posté par le seul commentateur, une vidéo assez remarquable nommée « les improbables mutations du SARS Cov 2 », d’une durée de 49’47, mise en ligne le 17/09/2020 par Stéphane GUAY (Mediainfocite.TV).
        https://www.youtube.com/watch?v=ge97kED72_U&feature=youtu.be

        @Bernard Dugué
        J’aimerais avoir votre avis sur cette vidéo-ci, que le profane que je suis a jugé passionnante, car ce qu’il y est dit à propos des travaux de Li-Meng YAN (affirmant que le SARS Cov2 a été créé à partir du virus militaire chinois ZC45), puis ce qu’il développe de lui-même sur les particularités « remarquables » constatées dans SARs Cov 2, ne sont pas contestables selon l’argumentation utilisée ici pour réfuter de façon trop « sachante » toute remarque s’éloignant du cadre de votre article.
        Une (éventuelle) réponse se devra d’être mieux formulée, et s’appuyer sur une réfutation sourcée...
        Quant à la critique formulée par vous sur la « qualité » de France Soir, est-elle liée au fait que les articles de Bio Moon (vous avez beaucoup échangé ensemble au printemps dernier sur Agoravox : provotella, etc...) y ont été repris (avec son accord) : https://www.francesoir.fr/prevotella-et-covid-19-la-science-appartient-tout-le-monde-par-bio-moon
        parce que pas mal d’articles qui y paraissent valent le coup d’être lus, et leur très longue étude (publiée en « feuilleton », non encore terminé) « L’histoire du covid19 » est une mine d’information (rédigé par Valère Lounnas et Gérard Guillaume).


      • Mélusine Enfayite Mélusine Enfayite 5 février 11:43

        C’est très intéressant tout ça.

        Mais on s’en fout complètement, sauf votre respect.

        Dans le blog Hémisphère Gauche de Libération, avant qu’il ne soit supprimé, a été publié un article /2020/04/22/origines-de-la-pandemie-lhypothese-americaine/

        et intitulé : Covid-19 a-t-il pu naître sur le territoire américain ? retrouvable sans problème je pense sur une wayback machine, et qui explique très bien son origine, située vraisemblablement à Fort Detrick, labo célèbre pour ses expériences dignes des camps, labo qui a subi des « fuites de matériel génétique » en juin juillet 2019 fermé précipitamment par l’administration US pendant plusieurs mois.

        Enquête avec toutes les précautions et conditionnels possibles, ça va sans dire, on est hébergé chez Libération.

        Il s’en est suivi sur la côte Est des épisodes de pneumopathies atypiques, comme relatées dans les journaux, d’abord dans des résidences pour séniors, bien vite cachées par les médias qui ont parlé d’épidémie de vapotage, puis un peu partout après selon la dispersion de personnels militaires dans différentes bases US puisqu’on retrouve par la suite un peu partout ce genre d’infections jusqu’à Hawaï et bien sûr en Italie, épicentre européen qui a vu les mêmes affections au cours de l’automne 2019.

        Puis en Italie, qui a vu la même épidémie à l’automne en Lombardie, Italie qui est le siège de nombreuses bases US Otan dont celle d’Aviano.

        Enfin, il faut souligner les jeux militaires mondiaux qui comme chacun sait se sont déroulés à Wuhan du18 AU 27 Octobre 2019, avec une équipe américaine réduite de la moitié ou presque de ses participants, logés dans un hôtel à deux pas du marché au pangolin violeur de chauve souris.

        Évènement qui a marqué de la même manière l’équipe tricolore puisque les journaux comme le Parisien en ont fait un article.

        Voilà, si cette modeste contribution a éclairé votre lanterne, tant mieux.


        • Bernard Dugué Bernard Dugué 5 février 11:48

          @Mélusine Enfayite
          Je connais ces infos qui ne prouvent rien
          les pneumopathies peuvent être occasionnée par le virus syncitial, le métapneumovirus et d’autres bestioles. Le CoV n’a pas le monopole sur les pneumonies. 


        • Francis, agnotologue Francis 5 février 12:02

          @Mélusine Enfayite
           
           ’’Covid-19 a-t-il pu naître sur le territoire américain ? ’’
           
          Ces divergences quant à l’origine de la chose pourraient peut-être expliquer la prolifération des variants ?


        • Mélusine Enfayite Mélusine Enfayite 5 février 13:23

          @Mélusine Enfayite
          Mes excuses pour les redondances.


        • Mélusine Enfayite Mélusine Enfayite 5 février 14:03

          @Bernard Dugué
          Certes oui, à part l’enchaînement chronologique des évènements qui est l’évidence logique même de l’origine du délit.
          Du Scénarios for the Future de la Fondation Rockefeller, jusqu’à l’évent 201, en passant par l’achat pour USD 400 millions par Bill Gates de la quote part des USA à l’OMS, pour arriver à l’aruspice Klaus Schwab du Forum de Davos et son Great Reset sous l’égide du prince Charles.
          Rajoutez le fait que les labos sont détenus par leurs plus gros fonds, Blackrock, Vanguard en tête, et même en France AXA ou Mamie Zinzin, qui contrôle une belle partie de la clinique française privée, à la tête de Sanofi pour au moins 6%, lequel va fabriquer sous licence l’ARNm de Pfizer, petite contrepartie pour l’abandon de son candidat.
          Je ne vous apprendrai pas que Pfizer, dont le CEO s’est bien goinfré au passage prévoit d’ailleurs 15 milliards de son poison, je vous laisse faire le calcul pour les autres initiateurs de la 4ème révolution industrielle qui produit les effets que vous savez chez au moins 3 millions de gens rien qu’en France.
          Il y a bien eu une guerre virale déclenchée pour imposer ce changement de paradigme industriel dans tous les secteurs de la vie économique, un great reset tout du moins dans les pays occidentaux sous emprise US/Young Leaders, les plus fortement touchés par les politiques imposées aux forceps par des décrets arbitraires et infondés.
          Vous ne pouvez pas passer sous silence la simultanéité de l’apparition de votre virus avec celle de l’Etat d’urgence opportun pour mettre en place une démocrature, dangereux comme une grosse grippe, et qui n’est qu’un cache sexe opportuniste du lock down des secteurs dont Schwab a annoncé la disparition d’environ 75% à l’issue de son reset.
          Secteurs qui seront repris pour une poignée de cacahuètes par la banque qui n’a plus qu’à attendre les faillites.
          Tous ces évènement suivent une même logique, mis bout à bout ils deviennent limpides, comme les décrets pris l’un après l’autre, de l’HCQ passé au Tableau II jusqu’au Rivotril® dans les Ehpads, l’épargne la plus forte y étant concentrée dans les pays développés.
          Qui peut cautionner un tel Hold Up ?


        • Mélusine Enfayite Mélusine Enfayite 5 février 14:09

          @Francis
          Il faudrait plutôt demander ça au spécialiste... Mais oui, si ce que je dis est vrai, N’importe qu’elle base américaine a pu être au départ d’un cluster.
          Reste à espérer un Little Big Horn  smiley


        • QAmonBra QAmonBra 5 février 12:44

          Merci @ l’auteur pour le partage.

          Je n’ai aucune connaissance en la matière, mais d’après notre prix Nobel national de médecine, j’ai nommé le professeur Luc Montagnier, il y a du VIH dans le génome du SRAS-CoV-2, son « bidouillage » génétique ne fait pour lui aucun doute, il a été le premier a l’affirmer à haute et claire voix, le confirmer avec le même aplomb et a été rejoint par d’autres véritables scientifiques depuis.

          Quand j’observe le cinéma que nous fait la ploutocratie et ses larbins avec cette grippe artificielle, statistiquement moins dangereuse que celle de 2017 et Ô combien ce « virus » leur est utile, pour faire accepter au citoyen lambda toutes les mesures liberticides, qu’il n’aurait jamais supporté sans ce terrorisme sanitaire, je n’ai aucune retenue a croire sur parole cet éminent scientifique, que ces tarés amateurs d’inversion accusatoire traitent de fou et de sénile. . .



          • Bernard Dugué Bernard Dugué 5 février 12:53

            @QAmonBra Aucun virologue sérieux ne valide la thèse de Montagnier
            La contagiosité du SARS-CoV-2 s’explique avec les propriétés de Spike hérités des virus animaux, plus le site furine avec un gain de fonction sans doute naturel. 


          • pierrot pierrot 5 février 13:17

            @QAmonBra
            Le Pr Montagnier a vieilli et son hypothèse n’est pas crédible.


          • Garibaldi2 5 février 13:49

            @pierrot

            Syndrome du Nobel. Ça avait commencé avec sa dérive sur le VIH. Un naufrage.

            Et qu’en est-il des visons comme vecteurs de la covid ?

            Lire : ttps ://www.francetvinfo.fr/replay-radio/le-billet-vert/covid-19-le-vison-dans-le-viseur-des-chercheurs-chinois_4235977.html



          • Opposition contrôlée Opposition contrôlée 5 février 14:06

            @Bernard Dugué
            Reste à définir un « virologue sérieux ». Sérieux vis-à-vis de son développement de carrière, de la sécurisation de ses budgets, ou vis-à-vis de l’intégrité ? Je ne prends pas parti dans le cas Montagnier, mais lui a l’avantage de la reconnaissance institutionnelle mérité, et de n’avoir plus aucun intérêt personnel, d’ego ou économique. 



          • ETTORE ETTORE 5 février 18:41

            @pierrot
            Le Pr Montagnier a vieilli et son hypothèse n’est pas crédible.
            __________________________________________________________________

            Et vous même ? Vous en êtes où ? Dites ?


          • Eric F Eric F 5 février 19:06

            @QAmonBra
            Dans le lien que vous indiquez « le CNRS qui commence a se poser des questions ? » , il est écrit en conclusion :
            "nous avons conduit des analyses phylogénétiques en collaboration avec des bio-informaticiens et des phylogénéticiens. Leurs résultats montrent que trois des quatre insertions
            [similaires à des séquences VIH] que l’on observe chez le SARS-CoV-2 se retrouvent chacune dans des souches plus anciennes de coronavirus. Notre étude indique de façon certaine que ces séquences sont apparues indépendamment, à différents moments de l’histoire évolutive du virus. Ces données invalident l’hypothèse d’une insertion récente et intentionnelle de ces quatre séquences par un laboratoire«  
            Selon l’article, cela réfute donc la thèse de Montagnier sur l’origine de ces »insertions", mais ses remarques sur leur rôle dans le SARS Cov2 restent valables.
            L’article juge plausible l’hypothèse d’une fuite accidentelle d’un virus de chauve souris acclimaté en laboratoire dans d’autres espèces.


          • Bernard Dugué Bernard Dugué 5 février 20:19

            @QAmonBra Les propos de Tritto relèvent d’une manipulation de données scientifiques arbitraire. Il prétend que la Chine n’a pas livré la séquence du génome, ce qui est faux, elle a été publié le 12 janvier par des virologues de Shanghai. Le labo a été fermé ensuite mais c’est une autre histoire. Pareil pour l’insert furine présenté comme un ancrage alors qu’il n’est pas sur le RBD. En gros, ce que dit Tritto n’est que du flan et du reste, je ne suis pas prêt de publier sur France Soir qui est devenu la voix du n’importe quoi. La question se pose mais les démonstrations fallacieuses, de Tritto ou Montagnier, n’ont pas leur place dans cette affaire



          • Eric F Eric F 6 février 10:07

            @Bernard Dugué
            Vos arguments de raison sont sans prise contre la certitude des croyances smiley


          • QAmonBra QAmonBra 6 février 14:33

            @Eric F

            (. . .) « sont sans prise contre la certitude des croyances »(. . .)

            Exactement ! Comme croire mordicus :

            • Que ce virus est naturel tout comme la ̶t̶e̶r̶r̶e̶u̶r̶ peur qu’il est sensé provoquer, chez les plus craintifs d’entre nous, soit, hélas,la grande majorité ;
            • Qu’ils nous préparent pas, grâce à leur bestiole trafiquée dans un labo, une « Tabula rasa » de leur système économico-financier en faillite, afin de lui substituer un autre plus perfectionné et rebondir ainsi de façon encore plus « démotactoriale » ;
            • Que les tours jumelles et la N°7 se sont effondrées suite aux incendies ;
            • Que le terrorisme des barbus sanguinaires, à l’étranger ou en France, n’est pas leur création et sous leur contrôle ;
            • Etc, etc.

            Bref ! Qu’il faut croire sur parole cette ploutocratie psychopathe et les nombreux vendus émargeant à son service, « scientifiques » ou non, prétendant nous informer, nous conseiller et nous protéger, nous « les 66 millions de procureurs » à qui ils devront effectivement rendre des comptes, tôt ou tard et quoi qu’il arrive

             ! . . .


          • pipiou2 6 février 17:19

            @troublefête
            Pourtant le « bêtisier » Raoult suffit à montrer que tout Nobel ou grand chercheur que l’on soit on peut dire de grosses bêtises, surtout si l’on manque d’humilité.

            La plus grosse erreur serait de mettre les Nobel sur un piedestal ; certains garnds scientifiques primés prennent d’ailleurs la grosse tête et perdent leurs repères


          • Durand Durand 7 février 01:33

            @Opposition contrôlée

            ..

            « plus aucun intérêt personnel, d’ego ou économique. »

            D’ego, rien n’est moins sur...

            ..


          • Durand Durand 7 février 02:07

            @QAmonBra

            ..

            « Le véritable danger n’est pas ce virus mais son « traitement » politique, économique et prétendument vaccinal. »

            Ca commence quand-même à sentir le roussi...

            ..

            « Mauvaise nouvelle pour Macron : son cabinet de conseil a été condamné à 573 millions de dollars pour fraude...

            ...Le cabinet de conseil américain, McKinsey, recruté par Emmanuel Macron dans sa campagne de vaccination vient d’être condamné à payer 573 millions de dollars pour fraude dans la crise des opioïdes qui avait fait 52 000 morts aux Etats-Unis

            ...McKinsey, le cabinet choisi par Emmanuel Macron a aidé le géant pharmaceutique Purdue Pharma à booster ses ventes d’OxyContin alors que le médicament faisait des ravages aux Etats-Unis. »

            https://lecourrier-du-soir.com/mauvaise-nouvelle-pour-macron-son-cabinet-americain-vient-detre-condamne-a-573-millions-de-dollars-pour-fraude/

            ,,

            « Ce cabinet a défrayé la chronique début janvier lorsqu’il a été révélé dans la presse qu’il a été recruté par le gouvernement français pour conseiller Emmanuel Macron dans sa gestion de la campagne de vaccination, notamment sur la question relative à la logistique. L’information a été confirmée par l’Elysée qui, cependant, n’a jamais voulu dévoiler le montant de la rémunération. Toutefois, dans la presse, on affirme que McKinsey a déjà touché au moins 100 millions d’euros de l’Etat français. »

            https://lecourrier-du-soir.com/mauvaise-nouvelle-pour-macron-son-cabinet-americain-vient-detre-condamne-a-573-millions-de-dollars-pour-fraude/

            ,,

            « Aujourd’hui, selon Le Monde, le cabinet McKinsey « rend quelques services à la présidence de la République » gratuitement. En 2018, il était intervenu au sommet de la tech dans lequel Emmanuel Macron avait invité les patrons de Facebook, Google ou Uber. Le cabinet était chargé de préparer les débats et suivre le respect des engagements. Une mission « pro bono » (« pour le bien public »). McKinsey intervient aussi auprès du ministère des Armées, qui échappe au contrôle de la DITP. Il apporte ses conseils pour la transformation du ministère. »

            https://www.ladepeche.fr/2021/02/05/qui-est-le-cabinet-mckinsey-qui-accompagne-emmanuel-macron-de-la-creation-den-marche-a-la-vaccination-contre-le-covid-19-9355298.php

            ,,

            Quand on sait que ce cabinet à joué un rôle clé dans la vente d’Alstom à G.E. et que Macron a laissé faire – pour ne pas dire favorisé – la transaction, peut être qu’au fond, les menus services rendus gratuitement à la présidence étaient payés d’avance !... McKinsey à dû faire un beau coup, à l’époque !

            Sans compter que McKinsey conseillait déjà (gratuitement ?) Macron pour sa campagne de 2017 !

            Mais McKinsey n’était pas le seul cabinet conseil sur l’affaire Alstom/G.E. ..., il y avait également le Boston Consulting Group, lui-aussi américain... Et c’est précisément à ce cabinet conseil que le général Pierre de Villiers, dès sa démission triomphale de l’Etat Major, est allé se vendre, lui, ses compétences et jusqu’à sa signature – soit-disant prestigieuse – le tout, très prisé, étant censé impressionner favorablement les conseils d’administration des sociétés qui sollicitent ces expertises. À ma connaissance, il y travaille toujours aujourd’hui...

            Non, ce n’est pas une autre histoire..., c’est le même monde, les mêmes squales, y compris jusqu’au plus haut niveau de La Défense Nationale.

            https://www.consultor.fr/tags/4972-le-bcg-et-mckinsey-chez-ge-pour-l-integration-d-alstom-energie.html

            ..


          • pierrot pierrot 5 février 13:16

            Article intéressant et didactique.

            Mais les hypothèses ne sont pas suffisamment étayées.

            Peut être que la mission actuelle de l’ONU donnera des compléments d’informations.

            Il ne faut pas oublier que les grandes pandémies du passé ont été générées par des mutations « naturelles » car la duplication d’une molécule d’ARN ou d’ADN est parfois l’objet d’une erreur.

            La plupart des mutations ne sont pas favorables et disparaissent par la mort de la cellule.


            • berry 5 février 13:46

              Le Dr Steven Quay estime à 99,8 % la probabilité que le Sars-CoV-2 provienne d’un laboratoire, et à seulement 0,2% la probabilité qu’il provienne de la nature.

              https://www.fawkes-news.com/2021/02/une-nouvelle-etude-du-dr-steven-quay.html#more


              • Eric F Eric F 5 février 17:34

                @berry
                Balancer des probabilités aussi tranchées (99.8 vs 0.2) ne plaide pas pour le sérieux d’une étude qui apparait alors sous le jour de la défense d’une thèse a-priori.
                En général, « en faire trop » est le signe d’une campagne orientée, on l’avait également vu dans l’étude anti HCQ du Lancet dont les chiffres étaient tellement excessifs qu’ils perdaient toute vraisemblance.


              • pierrot pierrot 5 février 19:13

                @berry
                pas sérieux


              • Eric F Eric F 6 février 10:09

                @pierrot
                Ce sont les mêmes qui affirmaient il y a quelques semaines à 99,8% de certitudes que Trump serait finalement élu.


              • Pic de la Mirandole Pic de la Mirandole 6 février 20:35

                @Eric F
                Ben on savait pas qu’il y aurait autant de fraude ! ducon !


              • malhorne malhorne 5 février 13:56

                buzyn levy veran cazeneuve devient être au courant bien sûr !!


                • sirocco sirocco 5 février 14:01

                  @l’auteur

                  « La fabrication d’un virus est un événement concevable mais l’accident de laboratoire [= la fuite accidentelle du virus hors du laboratoire] est très peu probable. »

                   

                  J’admire votre travail (et le temps que vous y passez probablement) à étudier le Covid-19.

                   

                  Cela dit, je suis extrêmement étonné que vous n’envisagiez pas une seule seconde la possibilité d’une fuite délibérée, volontaire, du virus hors du labo.

                   

                  Dans le monde de « loups pour l’homme » où nous vivons aujourd’hui et du principe de « pas de cadeau », le fait que l’hypothèse ne vous ait pas effleuré me laisse pantois...


                  • Mélusine Enfayite Mélusine Enfayite 5 février 16:27

                    @sirocco
                    Bonjour
                    Je suis aussi étonné que vous :
                    https://www.nytimes.com/2019/08/05/health/germs-fort-detrick-biohazard.html
                    Bio hasard ?
                    Il suffit de suivre le fil, l’épuration des éléments de preuve à charge dans les médias en général, tout comme l’article de blog de Libé cité plus haut n’empêchent pas de mettre en évidence les épisodes « hasardeux » qui se succèdent depuis maintenant un an et demi.
                    On peut même ajouter d’un point de vue « scientifique » que l’introduction d’un virus faite à l’été passera bien plus inaperçue et pourra progresser à bas bruit. Ce que d’ailleurs Mr Dugué ne semble pas en avoir tenu compte non plus, comme le reste.
                    Et comme pour confirmer le tout, après les purges staliniennes des Réseaux, c’est Wikimédia qui s’est mis au diapason. https://www.aubedigitale.com/wikipedia-lance-un-nouveau-code-de-conduite-qui-interdit-les-fausses-infos-et-le-trolling-et-encourage-lutilisation-de-pronoms-privilegies/
                    Et quand bien même Trump n’était pas l’initiateur, il n’a pas empêché le parti des milliardaires globalistes ni de faire commerce avec l’ennemi aux yeux bridés dont les dirigeants sont tout disposés à fournir la technologie orwellienne qui va avec le concert des nations civilisées, ni de jauger l’étendue réelle de l’épidémie en laissant en toute connaissance de cause tester la population avec des PCR à 90% faux positifs, comme un article du NYT du 29 Aout 2020 l’a révélé.
                    Un Trump qui a d’ailleurs battu tous les records en tonnage de carpet bombing en Afghanistan en 2019. C’est à ce prix-là, qu’on renouvelle le stock tout en engraissant le lobby militaro-industriel. Je le verrais bien aussi prix Nobel, comme l’a proposé malicieusement un jury norvégien présenté comme un populiste, l’époque est tout à fait raccord.
                    Make great America, celle des milliardaires de la Silicon Valley qui verrouillent tant bien que mal les canaux de discussion distants, même l’évocation des veillées autour d’un sanglier rôti assorties des palabres de nos aïeux auront été remplacées par une pizza Hut chacun en face de son écran, apportée par Deliveroo pour une société assignée et résignée  smiley


                  • Emohtaryp Emohtaryp 5 février 21:20

                    @sirocco

                    Cela dit, je suis extrêmement étonné que vous n’envisagiez pas une seule seconde la possibilité d’une fuite délibérée, volontaire, du virus hors du labo.

                    Autocensure ? On ménage la chèvre et le chou !

                    Bon et maintenant, il suffit juste de savoir à qui profite le crime si crime il y a.....En tout cas, certains font leurs choux gras de cette vérole, ça c’est indéniable... alors ? donc ? Oui, les suspicions sont forcément très grandes et bien au delà de l’effet d’aubaine et d’opportunisme....


                  • sirocco sirocco 5 février 21:33

                    @Mélusine Enfayite

                    « Je suis aussi étonné que vous »

                    Oui, hein. D’ailleurs il me semble avoir lu quelque part que certain oiseau de mauvais augure avait dit, il y a déjà quelques années, que le monde méritait une bonne méchante pandémie...


                  • sirocco sirocco 5 février 21:39

                    @Emohtaryp

                    « Autocensure ? On ménage la chèvre et le chou ! »

                    M. Dugué n’est sûrement pas un vrai complotiste !


                  • jib_jib 5 février 15:41

                    https://www.reseau-obepine.fr/seine-moree/

                    good news .les données obepine (eaux usées) sont « déclassées »


                    • pierrot pierrot 5 février 19:19

                      @jib_jib
                      Les informations issues des données « Obépine » concernant l’analyse du virus dans les eaux usées au niveau des stations de traitement des eaux usées est un bon indice de l’évolution de la pandémie.
                      Je suis les résultats. .


                    • ETTORE ETTORE 5 février 21:15

                      @pierrot
                      Les informations issues des données « Obépine » concernant l’analyse du virus dans les eaux usées au niveau des stations de traitement des eaux usées est un bon indice

                      Je suis les résultats. .

                      ______________________________________________________________
                      Enfin une vérité ! Oui, vous en êtes le résultat ! C’est sûr !


                    • pierrot pierrot 6 février 09:37

                      @ETTORE
                      Etant représentant des Parisiens, je reçoie les résultats des analyses « Obépine » qui sont de bons indices de suivi de la pandémie à Paris


                    • Sébastien A. 5 février 16:30

                      Bonjour Monsieur Dugué,

                      Je dois avouer ne pas être un spécialiste et que logiquement, je m’en remets à votre analyse scientifique qui me paraît équilibrée.

                      Je me permets juste de vous renvoyer vers une analyse faite par un collectif citoyen spécialisé dans la critique des technologies. Le point de vue est plus politique que scientifique, mais il n’est pas à balayer d’un revers de main, puisque nous sommes des animaux politiques avant d’être des sujets d’étude pour la science.

                      Là où je suis en désaccord avec vous, c’est sur les accidents de laboratoires, que vous qualifiez de « très peu probable » et qui sont au contraire légion.

                      Rien que pour le SRAS, celui-ci s’est « échappé » au moins à quatre reprises depuis 2003 (dixit E. Decroly que vous citez). Decroly ajoute (dans la revue du CNRS) que "[...] il faut savoir que les coronavirus étaient largement étudiés dans les laboratoires proches de la zone d’émergence du SARS-CoV-2 [...]« , ce qui devrait tout de même éveiller quelque peu notre curiosité. Même si nous n’avons rien à attendre de la part de la mission de l’OMS en Chine (dixit le monde). D’ailleurs ce même monde, france info et une quinzaine d’autres journaux »fiables" ont évoqué avec sérieux cette hypothèse qui n’est donc pas peu probable à mon sens. D’ailleurs, elle serait de nature à expliquer la panique qui s’empare de nos gouvernants face à cette épidémie qui n’est, finalement, pas si terrible que cela.

                      Le lien vers l’article :

                      http://www.piecesetmaindoeuvre.com/IMG/pdf/un_virus_scientifreak.pdf



                      • Bernard Dugué Bernard Dugué 5 février 19:11

                        @Sébastien A. Ma réponse à tous sera simple
                        Le gain de fonction, qui devrait être défini comme changement de tropisme, se produit dans la nature ou en labo. C’est un phénomène connu, pour la grippe ou les coronas. Déjà en 2000 en corona infectant les souris a été modifié en insérant une séquence spécifique au corona félin, du coup, le virus chimérique a infecté les félins mais plus les souris. Si un labo voulais créer un corona au tropisme modifié, il passerait par la case Spike. 
                        La Spike du SARS-CoV-2 présente quelques petites insertions la décalant des virus animaux connus. Il manque juste le virus intermédiaire, le SARS-X, manipulé en labo ou bien présent à l’état naturel ou même produit par l’humain au gré de mécanismes non connus. 


                      • Sébastien A. 6 février 22:35

                        @Bernard Dugué
                        Merci pour votre réponse. En ce qui me concerne, je me fous de la science et des protéines et de l’ordre de A, des G, des T et des R.
                        Par contre, je raisonne. Tout est question de probabilité. Qu’est-ce qui a le plus de chance de se produire dans la vie réelle (désolé pour la tautologie) :
                        A. qu’une chauve souris fasse 1500 km à tire-d’aile pour faire caca sur la tête d’un pangolin et qu’un quidam mange le pangolin infecté et que cela donne lieu à une pandémie mondiale
                        B. qu’un virus se soit échappé du seul laboratoire chinois qui travaillait sur ce genre de virus afin de les militariser.
                        Bref, on parle souvent du rasoir d’ockham, mais je pense qu’avec cette bête question, beaucoup risquent de se trancher la gorge...
                        Comme l’écrivait Bernanos, les scientifiques sont si souvent des imbéciles qu’on devrait les tenir comme tels jusqu’à ce qu’ils aient fait preuve du contraire.
                        On essaie de nous mener en bateau avec des débats qui n’ont ni queue, ni tête, alors que la réalité est toute simple. C’est d’ailleurs la seule raison qui explique ce vent de panique mondial.


                      • Eric F Eric F 5 février 17:53

                        @ l’auteur

                        L’étude présentée dans cet article devrait être soumise à des experts, en tant que contribution à une étude collective ou pour publication après relecture/remarques.

                        La prudence de la conclusion me parait préférable aux publication « à thèse » qui tranchent péremptoirement sur l’origine, en publiant des pourcentages de plausibilité contradictoires dans un sens ou dans l’autre.

                        La proximité de 96% avec une souche de 2013 concernant une famille de virus très évolutive est plus importante que celle entre le SARS et le MERS par exemple, lesquels étaient d’origine animale avec « saut d’espèce ». En 6 ans (entre 2013 et 2016), des mutations à bas bruit dans des espèces incubatrices à raison de 0,6% par an parait plausible. La situation de « chainons intermédiaires non identifiés » est fréquente, même si c’est préférable de les retrouver (mais peut-être sont-ils résorbés désormais ?).

                        Vous n’avez pas cité l’hypothèse d’insertion [en labo] de séquences de VIH, je suppose que c’est parce que ces séquences se trouvent en réalité aussi dans d’autres types de virus (étaient-elles aussi dans la souche de 2013 ?).


                        • ETTORE ETTORE 5 février 18:56

                           En gros finalement ? Vous privilégiez quoi ?

                          • La sauterie « Chauve qui sourit et PAN dans le golin »... ?
                          • Je ne fais pas gaffe, je ne me stérilise pas, et je sème à tous vents ?
                          • Comme ça merde chez moi, tu cours à l’autre bout de la terre, et tu te débrouille pour aller faire ton marché à Wuhan, en serrant la main de toutes les chauves souris et pangolins prostituées que tu trouve sur les étals ?
                          • Allez les Davossiens, on y vas, tous ensemble, on peut lancer l’enfumage, le matériel vas être livré, pour l’opération, nom de code « Nous sommes en guèèèère ».

                          J’hésite pour la 1.

                          Je doute pour la 2 .

                          J’ai des présomptions pour la 3 .

                          J’ai de la haine, pour la 4 .


                          • LeMerou 5 février 19:07

                            Argh. Faut suivre.

                            Si j’ai bien compris le C19 aurait comme origine un animal, mais avec un truc bizarre (code furine) qui n’est pas censé se trouver dans la nature, ou alors nous ne l’avons pas remarqué ?


                            • Bernard Dugué Bernard Dugué 5 février 19:12

                              @LeMerou Les codes furine sont présents sur beaucoup de virus, comme les codes trypsine, j’en ai trouvé sur des parvovirus


                            • pierrot pierrot 5 février 19:25

                              @Bernard Dugué
                              L’hypothèse d’une mutation d’un virus animal la plus plausible semble la chauve-souris.
                              Mais il reste des incertitudes.


                            • ETTORE ETTORE 5 février 21:11

                              @pierrot

                              pierrot 5 février 19:25

                              @Bernard Dugué
                              L’hypothèse d’une mutation d’un virus animal la plus plausible semble la chauve-souris.
                              Mais il reste des incertitudes
                              .

                              ___________________________________________________________________

                              C’est quand même dommage que vous n’ayez pas assisté au bang bang party organisé par les batmann pangol(H)énisés .

                              Imaginez seulement un instant, ce que vous auriez pu y apporter avec vos incertitudes latentes .


                            • Gilbert Spagnolo dit P@py Gilbert Spagnolo dit P@py 5 février 21:16

                              Sur Cnews retrouvez en replay l’émission du:05/02/21 :Ça se dispute, l’invité m’a surpris, il s’agit de Julien Dray

                              Vaccin:Bien mondial de l’humanité

                              Oublions la politique, je suis 100% d’accord avec lui.

                              A vous de voir l’émission.


                              @+ P@py


                              P.S.


                              Pour l’instant je regarde en direct l’émission, sitôt que l’url sera disponible je la place en réponse.


                              ,


                              • Citoyen de base 5 février 23:47

                                Bref, comme l’assassinat de Kennedy, comme pour les attentats du 11 septembre 2001, on ne saura probablement jamais la vérité. Mais on voit bien à qui profite le crime.  smiley


                                • yvesduc 6 février 07:58

                                  Merci pour votre article.

                                  Je n’ai pas de conviction mais Nicolas Lévine, qui a vécu le début de la crise depuis l’intérieur de la haute administration, rapporte avoir profité de nombreuses confidences mentionnant le labo P4 de Wuhan. Ses interlocuteurs considéraient la chose comme une quasi certitude, mais impossible à énoncer publiquement. Le laboratoire souffrait de vices de conception (des fuites !…) et son personnel n’était pas suffisamment formé, selon la délégation étasunienne qui a eu le privilège (rare) d’une visite.

                                  Bon, la Chine en a été le première victime donc la fuite serait plutôt accidentelle…


                                  • Eric F Eric F 6 février 10:18

                                    @yvesduc
                                    « la Chine en a été le première victime donc la fuite serait plutôt accidentelle »

                                    ...ou alors la fuite aurait été organisée par la Cabale pour qu’elle se propage dans le monde afin d’imposer la dictature planétaire du N.O.M., Même que c’est Attali et Bill Gates qui l’ont planifié (à moins que ce soit BHL et Soros). Il vont appliquer la Grande Recette (à moins que ce soit le Grand Reset).


                                  • pierrot pierrot 6 février 12:02

                                    @Eric F
                                    Je pense que c’est François Asselineau qui a répendu la pandémie par ses nombreux contacts sexuels non consentis !


                                  • ETTORE ETTORE 6 février 14:02
                                    pierrot 6 février 12:02

                                    Je pense que c’est François Asselineau qui a répendu la pandémie par ses nombreux contacts sexuels non consentis ;

                                    __________________________________________________________________

                                    Je suis persuadé, pourtant, qu’il ne vous arrive pas à la cheville, niveau « contacts » CON sentis !

                                    Môôôôsieur « le représentant P(H)arisien », des analyseurs d’égouts ! Ho bêê Pine !

                                    Pffff !


                                    • Mélusine Enfayite Mélusine Enfayite 6 février 15:44
                                      • Although many projects are on hold, Ms. Vander Linden said scientists and other employees are continuing to work, just not on select agents. She said many were worried about not being able meet deadlines for their projects.

                                        g the main story

                                        Missteps have occurred at other government laboratories, including those at the Centers for Disease Control and the National Institutes of Health. And in 2009, research at the institute in Fort Detrick was suspended because it was storing pathogens not listed in its database. The army institute also employed Bruce E. Ivins, a microbiologist who was a leading suspect — but who was never charged — in the anthrax mailings in 2001 that killed five people. Dr. Ivins died in 2008, apparently by suicide.........


                                      • Fort Detrick cultive et expérimente entre autres virus :


                                      • .........
                                      • Marburg virus [1]
                                      • Monkeypox virus [4]
                                      • Reconstructed replication competent forms of the 1918 pandemic influenza virus containing any portion of the coding regions of all eight gene segments (Reconstructed 1918 Influenza virus)
                                      • Ricin [6]
                                      • Rickettsia prowazekii
                                      • SARS-associated coronavirus (SARS-CoV) [5]
                                      • Saxitoxin [6]

                                      https://www.selectagents.gov/sat/list.htm?CDC_AA_refVal=https%3A%2F%2Fwww.selectagents.gov%2FSelectAgentsandToxinsList.html

                                      Si jamais je ne suis pas mort quand ce sera déclassifié, je reprendrai des moules à votre santé.


                                      • Mélusine Enfayite Mélusine Enfayite 6 février 16:44

                                        Fuites de Fort Detrick : suite

                                        Plusieurs des violations de laboratoire notées par le CDC en 2019 concernaient des « primates non humains » infectés par un « agent sélectionné », dont l’identité est inconnue - il a été expurgé dans tous les documents reçus, car la divulgation de l’identité et de l’emplacement de l’agent serait mettent en danger la santé ou la sécurité publique, dit l’agence.

                                        Le CDC a rapporté qu’un individu est entré partiellement dans une pièce plusieurs fois sans la protection respiratoire requise tandis que d’autres personnes dans cette pièce effectuaient des procédures avec un primate non humain sur une table d’autopsie.

                                        "Cet écart par rapport aux procédures de l’entité a entraîné une exposition professionnelle respiratoire à certains aérosols d’agent", a écrit le CDC.

                                        Dans cette observation, le CDC note que l’Institut de recherche médicale de l’armée américaine sur les maladies infectieuses a « systématiquement échoué à garantir la mise en œuvre de procédures de biosécurité et de confinement à la mesure des risques associés au travail avec certains agents et toxines.

                                        La violation spécifiquement observée concernait « le personnel de l’entité [...] ouvrant » une porte tout en retirant « de grandes quantités de déchets biologiques » d’une pièce adjacente, « [augmentant] le risque que l’air contaminé de [la pièce] s’échappe et soit aspiré. dans le [expurgé] »où les personnes qui travaillent« ne portent généralement pas de protection respiratoire ».

                                        Le CDC a signalé que le laboratoire ne s’assurait pas que la formation des employés était correctement vérifiée en ce qui concerne les toxines et la sélection des agents.

                                        « Ces échecs ont été reconnus grâce à l’examen vidéo des laboratoires travaillant dans les laboratoires BSL3 et ABSL3 », indique leur rapport. « [Ces] indiquent les moyens [du laboratoire] utilisés pour vérifier que le personnel comprenait que la formation n’avait pas été efficace, ce qui a entraîné un risque accru d’expositions professionnelles.

                                        Le CDC a poursuivi en précisant qu’un laborantin qui ne portait pas de protection respiratoire appropriée avait été vu à plusieurs reprises « entrer partiellement » dans une pièce où des primates non humains infectés par [expurgé] étaient « logés en cage ouverte ». Ils ont également observé un laborantin en train de jeter les déchets dans une poubelle présentant un danger biologique sans gants.

                                        .....


                                        • Mélusine Enfayite Mélusine Enfayite 6 février 16:55

                                          Johns Hopkins BSL-3 and ABSL-3 Laboratories ... JOHNS HOPKINS INSTITUTIONS. BSL-3 AND ... Integrated Research Facility at Fort Detrick, Maryland ...


                                          Dr Johns & Mister Hopkins... smiley


                                          • Rinbeau Rinbeau 6 février 18:03

                                            Pour moi la trame événementielle humaine qui entoure le COVID 19 donne une meilleure compréhension du phénomène en cours que l’explication virologique à proprement parler. Car quoiqu’on en dise personne ne connait le degrés des travaux menés en laboratoire, ni le niveau des connaissances des manipulations sur les virus. C’est cela qui fait dire au bout du compte, réservoir animal où manipulations génétiques, « on en sait rien » !

                                            Maintenant lorsqu’on se penche historiquement sur les périodes de guerre depuis la révolution Française, on se rend compte qu’elles sont toujours précédées de la création d’un contexte favorable à celles-ci. Et toujours à l’instigation des classes dominantes du moment. On appelle d’ailleurs ces périodes, l’avant guerre où la préparation des guerres.

                                            Or depuis l’invention des bombes nucléaires, les issues des guerres entre grandes puissances sont connues. Il n’y aurait pas de vainqueur mais que des perdants !

                                            Peuples et dominants à la fois réduits en cendres.

                                            Ce qui induit une différence colossale puisque les guerres conventionnelles faisaient irrémédiablement les peuples perdants et les dominants vainqueurs !

                                            Voilà pourquoi la nature des guerres a changé, (les Etats puissants s’en prenant à des pays pauvres avec des armées de métier, plus malléables dans un contexte géopolitique souvent plus qu’aléatoire). Mais guerre satisfaisant ( sans mauvais jeu de mots) pour les dominants puisque piller des pays pauvres, quel est l’intérêt ? Le pétrole me direz-vous ! oui quasi exclusivement ! Mais Ce qui a permis aux peuples des pays puissants de ne plus connaitre les guerres, avec la contrepartie d’une extrême paupérisation des peuples du monde entier. Les dominants tuant au passage la poule aux œufs d’or.

                                            Dans un temps économique déplorable et propice aux révolutions, la bonne vieille idéologie capitaliste du chaos pour désorganiser les masses est de nouveau indispensable. Nous aurions donc du voir se mettre en place depuis plusieurs années un contexte de guerre mondiale. Mais non ce n’est pas ce qui arrive !

                                            Depuis quelques années les dominants nous préparent un contexte de guerre oui.. Mais contre les virus. D’abord, un financement massif des banques envers les grandes firmes pharmaceutiques. Si vous voulez savoir quel sera l’ennemi, regardez où vont les finances des banques ! Ensuite la communication d’avant guerre ! Nous l’avons avec Attali, Bill Gates, Clinton, Rockefeller, etc.. La liste serait trop longue. Et pourtant ils ne sont que des philanthropes de surface. Et tout d’un coup survient le belligérant, le coup du pangolin ! Le coronavirus, intrépide adversaire, tel un Attila des temps lointains. Et Soudain, nous avons la déclaration de guerre, rappelez-vous Macron "Nous sommes en guerre !) !

                                            Puis s’en suivent les apocalyptiques prévisions des médecins généralistes sur les plateaux tv qui mettaient en garde contre un Verdun de la santé ! Propagande de guerre visant à terroriser la population et à la culpabiliser d’un même coup. Car dès le début, les dominants se rendent compte que ce virus n’est pas la peste, loin de là, et que malgré les chiffres hallucinants présentés sur les média mainstream, les adeptes de saint thomas ne voient pas de morts dans les rues. Le plan d’urgence sanitaire se déploie donc avec sa kyrielle de mesures liberticides, mais dans un environnement où beaucoup de gens le considère comme un non évènement.

                                            Que va t-il se passer ? Je ne sais pas. Mais pour ma part je ne crois pas aux prophéties autoréalisatrices qui surviennent rapidement lorsque tout un environnement se met en place pour qu’elles passent à l’œuvre.

                                            Et quand même, lorsque l’hypothèse du laboratoire est abordée, on envisage une sortie accidentelle mais il est intolérable d’envisager une intention volontaire.

                                            Et pourquoi donc messieurs les oligarques ? Serait-ce que parce la vérité n’est pas ailleurs ?



                                            • ETTORE ETTORE 6 février 20:00

                                              Rinbeau

                                              @

                                              Nous avons suffisamment de recul aujourd’hui pour analyser précisément, les procédures qui ont été mises en place.

                                              Même sans savoir, qui à eu l’initiative de la manipulation de« massacre »...

                                              Si nous partons d’aujourd’hui et remontons à la genèse de l’affaire, en y rattachant les diverses phases consécutives mises en place par le/les gouvernements....

                                              On commence à comprendre sans ambiguité, qui a monté ce cheval de Troie.

                                              Qui est caché dedans, et qu’elle est la prise souhaitée.

                                              Les négatifs, révèlent toujours les« positifs floutés » des mensonges.

                                              Surtout quand les sur-expositions, sont tellement volontaires !


                                              • Rinbeau Rinbeau 6 février 20:16

                                                @ETTORE

                                                 smiley



                                                • pierrot pierrot 7 février 11:10

                                                  @juan
                                                  Merci de commenter ce dépôt de brevet concernant cette protéine.


                                                • ETTORE ETTORE 7 février 14:00

                                                  juan@

                                                  Merci pour cette pépite.

                                                  Ne vous préoccupez pas des St Thomas comme le Pierre.

                                                  Il ne fait que rebondir sur une information donnée, histoire d’attirer l’attention sur ses éventuelles connaissances en la matière, cela s’arrête là !

                                                  Cette information change la donne, et le prouve. Et si nous la diffusons largement, elle pourrait changer bien des comportements larbins.

                                                  Merci à vous !


                                                  • BA 8 février 09:02

                                                    Lundi 8 février 2021 :


                                                    « Selon le groupe scientifique du gouvernement britannique, le NERVTAG, qui s’appuie sur plusieurs études, la variante anglaise serait plus mortelle d’entre 30% et 40%. »


                                                    Lisez cet article :


                                                    Variants sud-africain et brésilien du Covid-19 : la durée d’isolement allongée en cas d’infection.


                                                    La Direction générale de la Santé a diffusé, dimanche 7 février, une note urgente aux professionnels de santé. Elle détaille de nouvelles mesures à appliquer pour lutter contre la propagation des différents variants du Covid-19.


                                                    Isolement allongé, test négatif obligatoire de sortie... La Direction générale de la Santé (DGS) a transmis de nouvelles règles dans sa stratégie de lutte contre les variantes du Covid-19, dimanche 7 février. 


                                                    Pour prévenir la diffusion des deux variantes sud-africaine et brésilienne, la DGS a allongé la durée d’isolement des personnes contaminées à 10 jours. Un second test négatif est désormais obligatoire pour sortir de la quarantaine. Si ce test se révèle à nouveau positif, il faudra observer 7 jours d’isolement supplémentaires.


                                                    La DGS a également renforcé son dispositif de détection des variants à l’aide de tests antigéniques. Lors d’un test antigénique positif au Covid-19, un second prélèvement devra être réalisé pour rechercher la présence des variantes cette fois-ci. En cas de contamination à un variant, le laboratoire aura la responsabilité d’informer le patient.


                                                    Les trois principales variants du Covid-19 proviennent du Royaume-Uni, d’Afrique du Sud et du Brésil. Ils sont sources d’inquiétudes de la part des autorités sanitaires car plus contagieuses par rapport à la souche initiale du Covid-19.


                                                    Selon le groupe scientifique du gouvernement britannique, le NERVTAG, qui s’appuie sur plusieurs études, la variante anglaise serait également plus mortelle d’entre 30% et 40%.


                                                    https://www.lci.fr/sante/coronavirus-pandemie-epidemie-variants-sud-africain-et-bresilien-du-covid-19-la-duree-d-isolement-allongee-en-cas-d-infection-2177750.html


                                                    • DACH 9 février 00:30

                                                      D’où provient cette pandémie ? Réponse possible =

                                                      Nobel Prize winner of 2018, Japanese physician, scientist and immunologist, Dr Tasuku Honjo, caused a sensation today in the media by saying that the corona virus is not natural. if it is natural, it will not have affected the whole world like that. Because, depending on the nature, the temperature is different in different countries. if it were natural, it would only have affected countries with the same temperature as China. instead, it spreads to a country like Switzerland, the same way it spreads to desert areas. whereas if it were natural, it would have spread in cold places, but would have died in hot places. I have done 40 years of research on animals and viruses. It is not natural. It is manufactured and the virus is completely artificial. I have been working for 4 years in the Wuhan laboratory in China. I know all the staff of this laboratory well. I called them all after the Corona accident. but, all of their phones have been dead for 3 months. It is now understood that all of these laboratory technicians are dead.

                                                       Based on all of my knowledge and research to date, I can say this with 100% confidence that Corona is not natural. It did not come from bats.  China made it. if what I say today turns out to be false now or even after I die, the government can withdraw my Nobel Prize. but China is lying and this truth will one day be revealed to all.

                                                      • DACH 9 février 00:55

                                                        Ou encore....

                                                        Un article publié le 29 janvier par le Dr Steven Quay a conclu avec une probabilité de 99,8% que le virus causant le Covid-19 provenait d’un laboratoire, relate Associated Press en se référant à l’étude du scientifique publiée sur Zenodo, un dépôt général en libre accès géré par le CERN (Organisation européenne pour la recherche nucléaire).

                                                        Le but de cette recherche était de déterminer l’origine du virus SRAS-CoV-2.

                                                        Plus de 20 faits étudiés

                                                        Afin de trouver l’origine du virus, 26 faits et preuves différents et indépendants ont été examinés systématiquement. La conclusion est qu’avec une probabilité de 99,8% que le SRAS-CoV-2 provenait d’un laboratoire et seulement 0,2% de probabilité qu’il s’agit d’une zoonose naturelle.

                                                        « Comme beaucoup d’autres, je suis préoccupé par ce qui semble être des conflits d’intérêts importants parmi les membres de l’OMS et les scientifiques et médecins en Chine et à quel point cela empêchera un examen impartial de l’origine du SRAS-CoV-2 », a déclaré le scientifique.

                                                        Plus de 20 faits étudiés...................................



                                                        • @DACH

                                                          Bien d’accord avec toi, une fois n’est pas coutume. smiley


                                                        • DACH 9 février 11:00

                                                          @Philippe Huysmans, Complotologue=Bj, serais intéressant de me rappeler les sujets de désaccords ? (Pour l’auteur de ce jour ou les propos de l’un de notre équipe sous ce pseudo)


                                                        • pierrot pierrot 9 février 12:52

                                                          @DACH
                                                          Le rapport de l’OMS de ce jour : 09.02.2021 dit le contraire après une longue enquête approfondi : le virus ne provient pas d’un laboratoire P4 ou de virologie mais d’origine naturelle de chausse-souris probablement des grottes du sud de la Chine puis exposées sur le marché d’animaux vivant de Wuhan.


                                                        • pierrot pierrot 9 février 14:49

                                                          Lorsque l’on connait les principes de la conception des laboratoires P4 : secteurs de confinement bien séparés physiquement et surtout par les cascades de dépression du secteur interne vers le secteur externe etc. l’utilisation de scaphandre par les opérateurs, la procédure d’entrée et de sortie, les douches etc. il est hautement improbable qu’un virus puisse sortir du laboratoire.

                                                          Mais les conspirationnistes toujours ignorants croient ce qui les arrange par simple idéologie non rationnelle.

Ajouter une réaction

Pour réagir, identifiez-vous avec votre login / mot de passe, en haut à droite de cette page

Si vous n'avez pas de login / mot de passe, vous devez vous inscrire ici.


FAIRE UN DON



Publicité



Les thématiques de l'article


Palmarès



Publicité